| Publication No. | Title | Inventors | Assignee | Abstract | Date Filed | Date Published |
|---|---|---|---|---|---|---|
| WO00020027 | NOVEL METHODS FOR THERAPEUTIC VACCINATION | STEINAA L;MOURITSEN Sr;NIELSEN K;HAANING J;LEACH D;DALUM I;GAUTAM A;BIRK P;KARLSSON G; | BIOTECH E; | A method is disclosed for inducing cell-mediated immunity against cellular antigens. More specifically, the invention provides for a method for inducing cytotoxic T-lymphocyte immunity against weak antigens, notably self-proteins. The method entails that antigen presenting cells are induced to present at least one CTL epitope of the weak antigen and at the same time presenting at least one foreign T-helper lymphocyte epitope. In a preferred embodiment, the antigen is a cancer specific antigen, e.g. PSM, Her2, or FGF8b. The method can be exercised by using traditional polypeptide vaccination, but also by using live attenuated vaccines or nucleic acid vaccination. The invention furthermore provides immunogenic analogues of PSM, Her2 and FGF8b, as well as nucleic acid molecules encoding these analogues. Also vectors and transformed cells are disclosed. The invention also provides for a method for identification of immunogenic analogues of weak or non-immunogenic antigens | 1999 Oct 5 | 2000 Apr 13 |
| WO00026249 | IMMUNOTHERAPEUTIC METHODS USING EPITOPES OF WT.ndash.1 AND GATA.ndash.1 | STAUSS H;GAO L; | IMPERIAL COLLEGE INNOVATIONS LIMITED; | A peptide comprising the amino acid sequence RMFPNAPYL or a portion or variant thereof provided that the peptide is not intact human WT-1 polypeptide or a peptide comprising the amino acid sequence CMTWNQMNL or a portion or variant thereof provided that the peptide is not intact human WT-1 polypeptide or a peptide comprising the amino acid sequence HLMPFPGPLL or a portion or variant thereof provided that the peptide is not intact human gata-1 polypeptide, and polynucleotides encoding these peptides. The peptides and polynucleotides are useful as cancer vaccines | 1999 Nov 2 | 2000 May 11 |
| WO00029428 | POLYPEPTIDE | CARROLL M;MYERS K; | OXFORD BIOMEDICA (UK) LIMITED; | The present invention provides 5T4 tumour-associated antigen (TAA) for use in a method of immunotherapy of tumours. The invention also relates to a recombinant poxvirus vector from which at least one immune evasion gene has been deleted, which comprises a nucleic acid sequence encoding a 5T4 TAA and the use thereof in vaccinating against and in treating tumours | 1999 Nov 18 | 2000 May 25 |
| WO00071573 | IMMUNOGENIC PEPTIDES AND THE USE THEREOF | TRAVERSARI C;TANZARELLA S;BORDIGNON C; | GENERA SPA; | Peptides derived from proteins of the MAGE family and the use thereof as immunogenic agents in the treatment of tumors, the compositions containing them, a method for inducing a cytotoxic response against tumor cells, a melanoma cell line not expressing histocompatibility antigens and the applications thereof | 2000 May 17 | 2000 Nov 30 |
| WO00078806 | MAGE-A1 PEPTIDES PRESENTED BY HLA CLASS II MOLECULES | VAN SNICK J;LETHE B;CHAUX P;BOON-FALLEUR T;VAN DER BRUGGEN P; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention describes HLA class II binding peptides encoded by the MAGE-A1 tumor associated gene, as well as nucleic acids encoding such peptides and antibodies relating thereto. The peptides stimulate the activity and proliferation of CD4+ T lymphocytes. Methods and products also are provided for diagnosing and treating conditions characterized by expression of the MAGE-A1 gene | 2000 Jun 14 | 2000 Dec 28 |
| WO01004140 | COMPOUNDS FOR TREATMENT OF INFECTIOUS AND IMMUNE SYSTEM DISORDERS AND METHODS FOR THEIR USE | DELCAYRE A; | DEVELOPMENT CORPORATION LIMITED; | The present invention provides polypeptides comprising an immunogenic epitope of a M. vaccae protein, polynucleotides encoding such polypeptides, and fusion proteins comprising at least one such polypeptide, together with DNA constructs comprising at least one inventive polynucleotide. Compositions comprising such polypeptides, polynucleotides, fusion proteins and/or DNA constructs may be employed in the treatment of infectious diseases and immune disorders | 2000 Jul 10 | 2001 Jan 18 |
| WO01018035 | MUC-1 DERIVED PEPTIDES | TAYLOR-PAPADIMITRIOU J;HEUKAMP L;OFFRINGA R;MELIEF C;ACRES B;THOMAS M; | TRANSGENE SA;IMPERIAL CANCER RESEARCH TECHNOLOGY L; | Described are peptides and polypeptides derived from the MUC-1 polypeptide which are able to activate Cytotoxic T Lymphocyte (CTL) response, analogues of such peptides and polypeptides nucleotide sequences encoding such peptides and polypeptides and therapeutic uses thereof. Moreover, indications for selecting appropriate minimal antigenic MUC-1 polypeptides with reference to the HLA-type of the patient to be treated or tested are described | 2000 Sep 7 | 2001 Mar 15 |
| WO01021189 | INDUCING CELLULAR IMMUNE RESPONSES TO HEPATITIS C VIRUS USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS | SETTE A;SIDNEY J;SOUTHWOOD S;LIVINGSTON B;CHESNUT R;BAKER D;CELIS E;KUBO R;GREY H; | EPIMMUNE INC.;SETTE A;SIDNEY J;SOUTHWOOD S;LIVINGSTON B;CHESNUT R;BAKER D;CELIS E;KUBO R;GREY H; | This invention uses our knowledge of the mechanisms by which antigen is recognized by T cells to identify and prepare HCV epitopes, and to develop epitope-based vaccines directed towards HCV. More specifically, this application communicates our discovery of pharmaceutical compositions and methods of use in the prevention and treatment of HCV infection | 2000 Jul 19 | 2001 Mar 29 |
| WO01025793 | DIAGNOSTIC AND THERAPEUTIC EPITOPE, AND TRANSGENIC PLANT | ANDERSON R;HILL A;JEWELL D; | ISIS INNOVATION LIMITED;ANDERSON R;HILL A;JEWELL D; | A method of diagnosing coeliac disease, or susceptibility to coeliac disease, in an individual comprising : (a) contacting a sample from the host with an agent selected from (i) the epitope comprising sequence which is : SEQ ID NO : 1 or 2, or an equivalent sequence from a naturally occurring homologue of the gliadin represented by SEQ ID NO : 3, (ii) an epitope comprising sequence comprising : SEQ ID NO : 1, or an equivalent sequence from a naturally occurring homologue of the gliadin represented by SEQ ID NO : 3, which epitope is an isolated oligopeptide derived from a gliadin protein, (iii) an analogue of (i) or (ii) which is capable of being recognised by a T cell receptor that recognises (i) or (ii), which in the case of a peptide analogue is not more than 50 amino acids in length, or (iv) a product comprising two or more agents as defined in (i), (ii) or (iii), and (b) determining \Alt;i\Agt;in vitro\Alt;/i\Agt; whether T cells in the sample recognise the agent; recognition by the T cells indicating that the individual has, or is susceptible to, coeliac disease. Therapeutic compositions which comprise the epitope and gliadin proteins which do not cause coeliac disease are also provided | 2000 Oct 2 | 2001 Apr 12 |
| WO01029220 | MAGE-A12 ANTIGENIC PEPTIDES AND USES THEREOF | HEIDECKER L;VAN DEN EYNDE B;BOON-FALLEUR T;BRASSEUR F; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention provides antigenic peptides derived from MAGE-A12 polypeptides and presented by HLA molecules. Methods for diagnosis and treatment which involve the polypeptides also are provided | 2000 Oct 19 | 2001 Apr 26 |
| WO01053467 | RECOMBINANT FLAVIVIRUSES AND METHODS OF USE THEREOF | ANDINO-PAVLOVSKY R;MCALLISTER-MORENO A; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA; | The present invention provides recombinant flaviviruses, particularly live attenuated recombinant flavivirus, which comprise exogenous nucleotide sequences which encode exogenous amino acid sequences. These recombinant flavivirus viruses comprise an exogenous nucleic acid. Infection of a host cell with a recombinant flavivirus provides for expression of the exogenous nucleic acid in a host cell and production of an antigenic polypeptide encoded by the exogenous nucleic acid. Such recombinant flavivirus are useful in eliciting an immune response to the exogenous polypeptide | 2001 Jan 19 | 2001 Jul 26 |
| WO01058922 | METHOD AND COMPOSITIONS FOR TREATING HEPATOCELLULAR CANCER | ECONOMOU J;BUTTERFIELD L;RIBAS BRUGUERA A; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA; | A method for preventing or for treating cancer in a mammal, where the cancer cells express at least a part of an alpha fetoprotein molecule at the cell surface, the method comprising the step of creating an immune response in the mammal to at least part of the amino acid sequence of an alpha fetoprotein molecule, where the immune response comprises activating alpha fetoprotein peptide specific T lymphocytes against the cancer cells. A composition for preventing or for treating cancer comprising a peptide having at least part of the sequence of alpha fetoprotein | 2001 Feb 12 | 2001 Aug 16 |
| WO01060404 | TH1 INDUCING NATURAL ADJUVANT FOR HETEROLOGOUS ANTIGENS | REVETS H;CORNELIS P;DE BAETSELIER P; | VLAAMS INTERUNIVERSITAIR INSTITUUT VOOR BIOTECHNOLOGIE VZW; | The present invention relates to the use of the major OprI lipoprotein of Pseudomonas aeruginosa to elicit a Type-1 immune response towards a heterologous antigen. The invention relates specifically to the use of Oprl - antigen fusion proteins to elicit said Typ-1 response. More particurarly, the present invention is directed to pharmaceutical formulations comprising Oprl and/or Oprl fusion proteins, optionnaly together with a suitable excipient, to stimulate the Th1 dependent, cellular immune response | 2001 Feb 13 | 2001 Aug 23 |
| WO01070263 | COMPOSITION AND METHOD FOR THE PREVENTION AND/OR THE TREATMENT OF ALLERGY | SAINT-REMY JM;JACQUEMIN M; | DEVELOPMENT VZW LV; | The present invention is related to a method for modulating the immune system of a mammal patient towards an allergen, which comprises the step of inducing a pre-sensitisation of the immune system of said patient towards an immunogen carrying at least one T cell epitope homologous and functionally similar to an epitope present on said allergen and deriving from a naturally-occurring antigen in order to modify the response of said patient to a further sensitisation to said allergen, allowing that the immune response towards the allergen is modulated and that no allergy towards said allergen will be developed in said patient | 2001 Mar 16 | 2001 Sep 27 |
| WO01072331 | IMMUNOSTIMULATING PROPERTIES OF A FRAGMENT OF TGF-BETA | KAASTRUP P; | VACCINE CHIP TECHNOLOGY APS; | There is provided an immunogenic composition comprising at least one fragment of TGF-beta; capable of eliciting an immunostimulating effect in an individual, and at least one immunogenic determinant against which it is desirable to elicit an immunogenic response, wherein said at least one fragment of TGF-beta; and said at least one immunogenic determinant are not identical. Following immunisation, the effect exerted by the TGF-beta; fragment according to the invention results in the generation of an increased immunological response against the immunogenic determinant. By loading otherwise low immunogenic determinants into the vaccine chip according to the invention, thus generating an immunogenic composition according to the present invention, the immunogenic determinants will acquire an increased immunogenicity. There is also provided a vaccine formulation and a method for immunising an individual with the immunological compositions according to the invention | 2001 Mar 30 | 2001 Oct 4 |
| WO01072782 | IMMUNO-REACTIVE PEPTIDE CTL EPITOPES OF HUMAN CYTOMEGALOVIRUS | DIAMOND D; | CITY OF HOPE; | The invention provides a plurality of peptides (and immunologically functional variants thereof) which are immunogenic epitopes recognized by CD8+ class I MHC restricted cytotoxic T-lymphocytes of patients harboring latent human cytomegalovirus (HCMV) infection. The peptides are capable of activating CTLs and CTLps in the absence of active viral replication, and thus are useful for eliciting a cellular immune response against HCMV by normal and immunodeficient subjects. Peptide and lipopeptide vaccines, with and without adjuvants, also are disclosed. Cellular vaccines comprising the peptides form a further embodiment of this invention | 2001 Mar 16 | 2001 Oct 4 |
| WO01074848 | IDENTIFICATION OF POTENTIAL IMMUNODOMINANT ACETYLCHOLINE RECEPTOR ALPHA SUBUNIT PEPTIDES | DESHPANDE S;SPACK E;WEHNER N;ARIMILLI S; | CORIXA CORP; | The present invention is directed to the treatment of autoimmune diseases, in particular of Myasthenia Gravis. This invention provides novel autoimmune dominant peptides derived from the acetylcholine receptor, as well as methods for preparing the peptides. The present invention further provides complexes comprising these peptides associated with an appropriate major histocompatibility complex (MHC) molecule and methods for making these complexes. The complexes of the present invention can be used therapeutically or prophylactically for treating Myasthenia Gravis | 2001 Mar 30 | 2001 Oct 11 |
| WO01074859 | A GENE DIFFERENTIALLY EXPRESSED IN BREAST AND BLADDER CANCER AND ENCODED POLYPEPTIDES | ZAUDERER M;EVANS E;BORRELLO M; | UNIVERSITY OF ROCHESTER; | The present invention relates to a novel human gene that is differentially expressed in human carcinoma. More specifically, the present invention relates to a polynucleotide encoding a novel human polypeptide named C35 that is overexpressed in human breast and bladder carcinoma. This invention also relates to C35 polypeptides, as well as vectors, host cells, antibodies directed to C35 polypeptides, and the recombinant methods for producing the same. The present invention further relates to diagnostic methods for detecting carcinomas, including human breast carcinomas. The present invention further relates to the formulation and use of the C35 gene and polypeptides in immunogenic compositions or vaccines, to induce antibody or cell-mediated immunity against target cells, such as tumor cells, that express the C35 gene. The invention further relates to screening methods for identifying agonists and antagonists of C35 activity | 2001 Apr 4 | 2001 Oct 11 |
| WO01078767 | PHARMACEUTICAL PREPARATIONS COMPRISING MODIFIED PEPTIDES | MATTNER F;ZAUNER W;SCHMIDT W;BUSCHLE M; | CISTEM BIOTECHNOLOGIES GMBH; | Pharmaceutical preparation comprising a peptide of the formula : XN - PeptideL - XM; wherein X is an amino acid residue selected from Gly, Ala, Val, Leu, Ile, Pro, Phe, Tyr, Trp, Cys, Met, Glu and Asp; PeptideL is a potentially immunogenic fragment consisting of L amino acid residues; L is an integer from 6 to 100, N and M are integers from 0 to 2L, with the proviso that either N or M is at least 2; XN and XM being amino acid sequences not occurring at this position and in this constellation with PeptideL and a polycationic substance | 2001 Apr 17 | 2001 Oct 25 |
| WO01078768 | TARGETED VACCINE DELIVERY SYSTEMS | ZAUDERER M;SMITH E; | UNIVERSITY OF ROCHESTER; | The present invention is directed to a novel targeted vaccine delivery system, comprising one or more MHC-peptide complexes linked to an antibody which is specific for a cell surface marker. The complexes of the invention are useful for treating and/or preventing cancer, infectious diseases, autoimmune diseases, and/or allergies | 2001 Apr 12 | 2001 Oct 25 |
| WO01079259 | JAVELINIZATION OF PROTEIN ANTIGENS TO HEAT SHOCK PROTEINS | ROTHMAN JAME;MAYHEW MARK;HOE MEE; | ROTHMAN J;MAYHEW M;HOE M; | The present invention relates to antigenic complexes, wherein an antigenic complex comprises a peptide or protein containing a plurality of epitopes non-covalently joined to a heat shock protein via a molecular tether referred to as a 'javelin'. Such complexes do not require that each epitope Be defined, and may, in certain embodiments, elicit both antibody and cell-mediated immune reactions. The complexes of the invention may be used to induce therapeutic immune responses directed toward the treatment or prevention of infectious diseases and malignancies | 2001 Apr 17 | 2001 Oct 25 |
| WO01082963 | EPITOPE SYNCHRONIZATION IN ANTIGEN PRESENTING CELLS | SIMARD J;DIAMOND D;LEI XD; | CTL IMMUNOTHERAPIES CORP.; | Disclosed herein are vaccines and methods for inducing an immune response against cancer cells and cells infected with intracellular parasites. Vaccines having housekeeping epitopes are disclosed. The housekeeping epitope is formed by housekeeping proteasomes in peripheral cells, but not by professional antigen presenting cells. A vaccine containing a housekeeping epitope that is derived from an antigen associated with a peripheral target cell can thus direct an immune response against the target cell. Methods of treatment are also disclosed, which involve administering a vaccine having a housekeeping epitope | 2001 Apr 27 | 2001 Nov 8 |
| WO01085204 | THERAPEUTIC METHOD AND COMPOSITION UTILIZING ANTIGEN-ANTIBODY COMPLEXATION AND PRESENTATION BY DENDRITIC CELLS | SCHULTES B;NOUJAIM A; | ALTAREX CORP.; | Disclosed are methods and compositions for use in immunotherapy. These methods and compositions are particularly useful for exploiting dendritic cells to present an antigen to a patient, particularly where the patient has a disease associated with the antigen. The invention provides methods for treating a patient having a disease associated with an antigen. The methods according to the invention comprise combining ex vivo an antigen and an antigen-presenting cell binding agent specific for the antigen, and administering the composition to a patient suffering from a disease associated with the antigen, wherein the patient receives a therapeutic benefit | 2001 May 11 | 2001 Nov 15 |
| WO01090152 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF BREAST CANCER | FRUDAKIS T;REED S;SMITH J;MISHER L;DILLON D;RETTER M;WANG A;SKEIKY Y;HARLOCKER S;DAY C; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly breast cancer, are disclosed. Illustrative compositions comprise one or more breast tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly breast cancer | 2001 May 22 | 2001 Nov 29 |
| WO01093903 | ANTIGENIC COMPOSITION COMPRISING A POLYCATIONIC PEPTIDE AND INOSINE AND CYTOSINE | EGYED A;LINGNAU K;MATTNER F;BUSCHLE M;SCHMIDT W; | CISTEM BIOTECHNOLOGIES GMBH; | The invention relates to a composition comprising: a T cell epitope or a mixture of T cell epitopes, a polycationic peptide and a nucleic acid based on inosin and cytosin and its use as a vaccine | 2001 Jun 7 | 2001 Dec 13 |
| WO02000174 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER | WANG T;WANG A;SKEIKY Y;LI S;KALOS M;HENDERSON R;MCNEILL P;FANGER N;RETTER M;MARNERAKIS M;FANGER G;VEDVICK T;CARTER D;WATANABE Y;PECKHAM D; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer | 2001 Jun 28 | 2002 Jan 3 |
| WO02004514 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER | WANG T;WATANABE Y;HENDERSON R;JOHNSON J;RETTER M;DURHAM M;CARTER D;FANGER G;VEDVICK T;BANGUR C;MCNABB A;WANG A;FANGER N;SWITZER A;MCNEILL P;CLAPPER J; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer | 2001 Jul 10 | 2002 Jan 17 |
| WO02013765 | MALARIA IMMUNOGEN AND VACCINE | BIRKETT A; | APOVIA I; | A chimeric, carboxy-terminal truncated hepatitis B virus nucleocapsid protein (HBc) is disclosed that contains an immunogen for inducing the production of antibodies to malarial proteins. An immunogenic malarial epitope is expressed between residues 78 and 79 of the HBc immunogenic loop sequence. The chimer preferably contains a malaria-specific T cell epitope and is preferably engineered for both enhanced stability of self-assembled particles and enhanced yield of those chimeric particles. Methods of making and using the chimers are also disclosed | 2001 Aug 16 | 2002 Feb 21 |
| WO02026778 | ISOLATED PEPTIDES WHICH BIND TO HLA-C MOLECULES AND USES THEREOF | GNJATIC S;OLD L;NAGATA Y;JAGER E;CHEN YT;KNUTH A; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention teaches peptide epitopes which bind to HLA-Cw3 and HLA-Cw6 molecules on the surface of cells. The peptides are useful diagnostically and therapeutically, as are DNA molecules which encode them, and the cytolytic T lymphocytes specific to the HLA/peptide complexes. Also a feature of the invention is a method for identifying relevant molecules such as those described herein, in a system that uses stimulation and restimulation using different viral vectors | 2001 Sep 24 | 2002 Apr 4 |
| WO02036611 | IMMUNOMODULATORY PEPTIDES DERIVED FROM HEAT SHOCK PROTEINS AND USES THEREOF | ALBANI SALV;CARSON D;PRAKKEN B; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA;MARTINI A; | A method of modulating an immune response in a subject is disclosed. The invention is based on the discovery that an effective therapeutic strategy for ameliorating the inflammation-related symptoms of an immune-mediated disease, such as arthritis, can be achieved by modulation of the underlying immune response itself, rather than by merely addressing the resulting inflammation. This strategy can be used to regulate the inflammatory response and is applicable to a variety of contexts in which immune modulation is desired, such as mucosal tolerization, DNA vaccination, anergy induction, active immunization, and ex vivo modulation of antigen-specific T cells. In one embodiment, the method comprises administering to the subject a bacterial dnaJ peptide or a human homolog or a non-homologous human isoform thereof | 2001 Oct 31 | 2002 May 10 |
| WO02051860 | SYNTHETIC PEPTIDE COMPOSITION AS IMMUNOGENS FOR PREVENTION OF URINARY TRACT INFECTION | WANG C; | UNITED BIOMEDICAL INC.; | The inventio provides a peptide immunogen comprising a FAFSD target peptide or an analogue thereof, covalently linked to a helper T cell epitope and optionally to an invasin immunostimulatory domain. The present invention also provides for the use of such peptide immunogens to elicit the production in mammals of high titer polyclonal antibodies, which are specific to the FAFSD target peptide. The peptide immunogens are expected to be useful in evoking antibodies that prevent the adherence of E. coli and other enterobacteria to the bladder mucosa for protection agains urinary tract infection | 2001 Dec 21 | 2002 Jul 4 |
| WO02070006 | LONG PEPTIDES OF 22-45 AMINO ACID RESIDUES THAT INDUCE AND/OR ENHANCE ANTIGEN SPECIFIC IMMUNE RESPONSES | VAN DER BURG SH;OTTENHOF T;GELUK A;SCHOENMAEKERS-WELTERS MJP;DE JONG A;OFFRINGA R;MELIEF C;TOES R; | ACADEMISCH ZIEKENHUIS LEID; | The invention is concerned with epitopes derived from human papilloma virus, and peptides having a size of about 22-45 amino acid residues comprising minimal T cell epitopes. The invention further provides clinically relevant approaches for immunizing subjects against (Myco)bacterially and/or virally infected cells or tumor cells, and in particular against HPV. The invention demonstrates that peptide sequences of 22-35 amino acid residues in length can induce both peptide-specific CD8+ cytolytic cells and CD4+ T-helper cells. Moreover, the invention demonstrates that vaccination with 22-35 residue long peptides results in a more vigorous CD8+ cytolytic T-cell response than vaccination with peptides of the exact minimal CTL epitope length. The invention further demonstrates that the intrinsic capacity of certain minimal CTL epitopes which instead of activating cytolytic effector cells tolerize these cytolytic cells, can be overcome by use of these 22-35 amino acid long peptides. The invention further provides clinically relevant approaches for vaccination and/or treatment of subjects against HPV. The invention also provides methods and uses suited to treat subjects suffering from progressive lesions and/or cervical cancer | 2001 Dec 7 | 2002 Sep 12 |
| WO01090152 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF BREAST CANCER | FRUDAKIS T;REED S;SMITH J;MISHER L;DILLON D;RETTER M;WANG A;SKEIKY Y;HARLOCKER S;DAY C; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly breast cancer, are disclosed. Illustrative compositions comprise one or more breast tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly breast cancer | 2001 May 22 | 2001 Nov 29 |
| WO01093903 | ANTIGENIC COMPOSITION COMPRISING A POLYCATIONIC PEPTIDE AND INOSINE AND CYTOSINE | EGYED A;LINGNAU K;MATTNER F;BUSCHLE M;SCHMIDT W; | CISTEM BIOTECHNOLOGIES GMBH; | The invention relates to a composition comprising: a T cell epitope or a mixture of T cell epitopes, a polycationic peptide and a nucleic acid based on inosin and cytosin and its use as a vaccine | 2001 Jun 7 | 2001 Dec 13 |
| WO02000174 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER | WANG T;WANG A;SKEIKY Y;LI S;KALOS M;HENDERSON R;MCNEILL P;FANGER N;RETTER M;MARNERAKIS M;FANGER G;VEDVICK T;CARTER D;WATANABE Y;PECKHAM D; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer | 2001 Jun 28 | 2002 Jan 3 |
| WO02004514 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER | WANG T;WATANABE Y;HENDERSON R;JOHNSON J;RETTER M;DURHAM M;CARTER D;FANGER G;VEDVICK T;BANGUR C;MCNABB A;WANG A;FANGER N;SWITZER A;MCNEILL P;CLAPPER J; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer | 2001 Jul 10 | 2002 Jan 17 |
| WO02013765 | MALARIA IMMUNOGEN AND VACCINE | BIRKETT A; | APOVIA I; | A chimeric, carboxy-terminal truncated hepatitis B virus nucleocapsid protein (HBc) is disclosed that contains an immunogen for inducing the production of antibodies to malarial proteins. An immunogenic malarial epitope is expressed between residues 78 and 79 of the HBc immunogenic loop sequence. The chimer preferably contains a malaria-specific T cell epitope and is preferably engineered for both enhanced stability of self-assembled particles and enhanced yield of those chimeric particles. Methods of making and using the chimers are also disclosed | 2001 Aug 16 | 2002 Feb 21 |
| WO02026778 | ISOLATED PEPTIDES WHICH BIND TO HLA-C MOLECULES AND USES THEREOF | GNJATIC S;OLD L;NAGATA Y;JAGER E;CHEN YT;KNUTH A; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention teaches peptide epitopes which bind to HLA-Cw3 and HLA-Cw6 molecules on the surface of cells. The peptides are useful diagnostically and therapeutically, as are DNA molecules which encode them, and the cytolytic T lymphocytes specific to the HLA/peptide complexes. Also a feature of the invention is a method for identifying relevant molecules such as those described herein, in a system that uses stimulation and restimulation using different viral vectors | 2001 Sep 24 | 2002 Apr 4 |
| WO02036611 | IMMUNOMODULATORY PEPTIDES DERIVED FROM HEAT SHOCK PROTEINS AND USES THEREOF | ALBANI SALV;CARSON D;PRAKKEN B; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA;MARTINI A; | A method of modulating an immune response in a subject is disclosed. The invention is based on the discovery that an effective therapeutic strategy for ameliorating the inflammation-related symptoms of an immune-mediated disease, such as arthritis, can be achieved by modulation of the underlying immune response itself, rather than by merely addressing the resulting inflammation. This strategy can be used to regulate the inflammatory response and is applicable to a variety of contexts in which immune modulation is desired, such as mucosal tolerization, DNA vaccination, anergy induction, active immunization, and ex vivo modulation of antigen-specific T cells. In one embodiment, the method comprises administering to the subject a bacterial dnaJ peptide or a human homolog or a non-homologous human isoform thereof | 2001 Oct 31 | 2002 May 10 |
| WO02051860 | SYNTHETIC PEPTIDE COMPOSITION AS IMMUNOGENS FOR PREVENTION OF URINARY TRACT INFECTION | WANG C; | UNITED BIOMEDICAL INC.; | The inventio provides a peptide immunogen comprising a FAFSD target peptide or an analogue thereof, covalently linked to a helper T cell epitope and optionally to an invasin immunostimulatory domain. The present invention also provides for the use of such peptide immunogens to elicit the production in mammals of high titer polyclonal antibodies, which are specific to the FAFSD target peptide. The peptide immunogens are expected to be useful in evoking antibodies that prevent the adherence of E. coli and other enterobacteria to the bladder mucosa for protection agains urinary tract infection | 2001 Dec 21 | 2002 Jul 4 |
| WO02070006 | LONG PEPTIDES OF 22-45 AMINO ACID RESIDUES THAT INDUCE AND/OR ENHANCE ANTIGEN SPECIFIC IMMUNE RESPONSES | VAN DER BURG SH;OTTENHOF T;GELUK A;SCHOENMAEKERS-WELTERS MJP;DE JONG A;OFFRINGA R;MELIEF C;TOES R; | ACADEMISCH ZIEKENHUIS LEID; | The invention is concerned with epitopes derived from human papilloma virus, and peptides having a size of about 22-45 amino acid residues comprising minimal T cell epitopes. The invention further provides clinically relevant approaches for immunizing subjects against (Myco)bacterially and/or virally infected cells or tumor cells, and in particular against HPV. The invention demonstrates that peptide sequences of 22-35 amino acid residues in length can induce both peptide-specific CD8+ cytolytic cells and CD4+ T-helper cells. Moreover, the invention demonstrates that vaccination with 22-35 residue long peptides results in a more vigorous CD8+ cytolytic T-cell response than vaccination with peptides of the exact minimal CTL epitope length. The invention further demonstrates that the intrinsic capacity of certain minimal CTL epitopes which instead of activating cytolytic effector cells tolerize these cytolytic cells, can be overcome by use of these 22-35 amino acid long peptides. The invention further provides clinically relevant approaches for vaccination and/or treatment of subjects against HPV. The invention also provides methods and uses suited to treat subjects suffering from progressive lesions and/or cervical cancer | 2001 Dec 7 | 2002 Sep 12 |
| WO03000720 | NOVEL HUMAN CYTOMEGALOVIRUS (HCMV) CYTOTOXIC T CELL EPITOPES, POLYEPITOPES, COMPOSITIONS COMPRISING SAME AND DIAGNOSTIC AND PROPHYLACTIC AND THERAPEUTIC USES THEREFOR | KHANNA R;ELKINGTON R;WALKER S; | THE COUNCIL OF THE QUEENSLAND INSTITUTE OF MEDICAL RESEARCH; | The present invention provides CTL epitope peptides and polyepitope peptides from 14 distinct antigens of human cytomegalovirus (HCMV) that are restricted through HLA the most commonly prevalent class I alleles in different ethnic populations of the world. These epitopes provide an important platform for CTL epitope-based vaccines against HCMV. The present invention further provides vaccine composiitons comprising the subject epitope and polyepitope peptides and methods for vaccination of humans and for the adoptive transfer of HCMV-specific T cells to human subjects. The present invention further provides reagents and methods for determining the HCMV status or level of HCMV-specific immunity of a subject | 2002 Jun 26 | 2003 Jan 3 |
| WO03001204 | TYPE 1 DIABETES DIAGNOSTICS AND THERAPEUTICS | TAN R;VERCHERE B;TRUDEAU J; | THE UNIVERSITY OF BRITISH COLUMBIA; | The invention provides compounds and methods useful for the diagnosis, prediction, therapy, or prophylaxis of type 1 diabetes. The compounds of the invention include peptides derived from IAPP (islet amyloid polypeptide) precursor peptides | 2002 Jun 25 | 2003 Jan 3 |
| WO03002602 | NOGO AND NOGO RECEPTOR DERIVED PEPTIDES FOR T-CELL MEDIATED NEUROPROTECTION | EISENBACH-SCHWARTZ M;HAUBEN E; | YEDA RESEARCH AND DEVELOPMENT CO.LTD.; | An agent selected from: (a) a peptide derived from a Nogo or a Nogo receptor molecule and (b) autologous T cells recognizing a peptide of (a) in the context of class II MHC molecules, is provided for conferring neuroprotection and thus preventing or inhibiting neuronal degeneration in the central nervous system for ameliorating the effects of injury, disorder or disease | 2002 Jun 27 | 2003 Jan 9 |
| WO03006047 | METHODS FOR REDUCING IMMUNOGENICITY OF POLYPEPTIDES | CARR F;CARTER G;HELLENDOORN K; | MERCK PATENT GMBH; | This invention relates to the fields of immunology and protein therapeutics. The therapeutic proteins are polypeptides to be administered especially to humans. The polypeptides are modified whereby the modification results in a reduced propensity for the polypeptide to elicit an immune response upon administration to the human subject. The invention therefor provides methods for the development of therapeutic polypeptides that are less immunogenic than any non-modified counterpart when used in vivo. The modifications used according to this invention relate, for example, to the introduction of protease cleavage sites, attachment of different molecules or insertion of non-natural amino acids | 2002 Jul 12 | 2003 Jan 23 |
| WO03008537 | EPITOPE SEQUENCES | SIMARD J;DIAMOND D;LIU L;XIE Z; | MANNKIND CORPORATION; | Disclosed herein are polypeptides, including epitopes, clusters, and antigens. Also disclosed are compositions including said polypeptides and methods for their use | 2002 Mar 29 | 2003 Jan 30 |
| WO03011331 | MATERIALS AND METHODS RELATING TO IMPROVED VACCINATION STRATEGIES | CERUNDOLO V;PALMOWSKI M;MAN-LIK CHOI E; | ISIS INNOVATION LIMITED; | The invention provides novel vaccination strategies based on a prime-boost vaccination regimen. The inventors have determined improved ways of boosting an immune response in a patient previously primed or exposed to a plurality of epitopes. The improved method requires the epitopes in the boosting phase to be administered individually, i.e. held on separate peptide constructs | 2002 Jul 30 | 2003 Feb 13 |
| WO03011332 | METHODS RELATING TO IMPROVED POLYEPITOPE VACCINATION STRATEGIES | CERUNDOLO V;PALMOWSKI M;MAN-LIK CHOI E; | ISIS INNOVATION LIMITED; | The invention provides improved vaccination strategies based on a prime-boost vaccination regimen. The inventors have determined a novel method of boosting an immune response in an individual already primed by a plurality of epitopes, to ensure the immune response is boosted equally for all epitopes. The method involves the administration of the plurality of epitopes separately by using a plurality of nucleic acid constructs each encoding one of the epitopes | 2002 Jul 30 | 2003 Feb 13 |
| WO03011895 | COMPOSITIONS AND METHODS FOR MODULATION OF IMMUNE RESPONSES | SOEDERSTROEM KARL; | S?ERSTR? K; | The present invention relates to a novel mechanism for modulation of immune response. More closely, the present invention relates to modulation of 5 CD94/NKG2 receptor function by HLA-E + bound peptides causing either inhibition or absence of inhibition of said receptors. In a preferred embodiment the invention relates to HLA-E binding hsp (heat shock protein) 60 peptides | 2002 Jul 31 | 2003 Feb 13 |
| WO03014154 | VACCINES AGAINST KAPOSI'S SARCOMA-ASSOCIATED HERPESVIRUS | BOSHOFF C; | UNIVERSITY COLLEGE LONDON; | CD8 T cell epitopes derived from Kaposi's sarcoma herpesvirus (KSHV) have the formula (I): X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15 wherein - X1 is E, X2 is L, X3 is T, X4 is D, X5 is A, X6 is L, X7 is I, X8 is S, X9 is A, X10 is F, X11 is S, X12 is G, X13 is S, X14 is Y and X15 is S; - X1 is L, X2 is I, X3 is L, X4 is Y, X5 is L, X6 is C, X7 is V, X8 is P, X9 is R, X10 is C, X11 is R, X12 is R, X13 K, X14 K and X15 is P; - X1 is G, X2 is H, X3 is R, X4 is Q, X5 is S, X6 is I, X7 is W, X8 is I, X9 is T, X10 is W, X11 is R, X12 is A, X13 is Q, X14 is P and X15 is V; - X1 is R, X2 is A, X3 is Q, X4 is P, X5 is V, X6 is L, X7 is Q, X8 is T, X9 is L, X10 is C, X11 is A, X12 is Q, X13 is P, X14 is S and X15 is N; or - X1 is T, X2 is A, X3 is T, X4 is A, X5 is A, X6 is G, X7 is L, X8 is S, X9 is L, X10 is S, X11 is S, X12 is I, X13 is Y, X14 is L and X15 is G. Polypeptides comprising an epitope sequence and polynucleotides encoding such polypeptides are useful for vaccinating a host against KSHV infection | 2002 Aug 5 | 2003 Feb 20 |
| WO03015716 | IMMUNOGLOBULIN E VACCINES AND METHODS OF USE THEREOF | CHEN SSA;YANG YM;BARANKIEWICZ T;CHEN Z; | IGE THERAPEUTICS I; | The present invention concerns the prophylaxis or therapy of immunoglobulin E-mediated disease conditions. The present invention discloses methods for identifying peptides that induce a cytotoxic T-lymphocyte response against immunoglobulin E. The present invention further discloses compositions that are able to elicit in a mammal a cytotoxic T-lymphocyte response to naturally processed and presented immunoglobulin E peptides, and methods for their use | 2002 Aug 8 | 2003 Feb 27 |
| WO03018610 | PEPTIDES OF MELANOMA ANTIGEN AND THEIR USE IN DIAGNOSTIC, PROPHYLACTIC AND THERAPEUTIC METHODS | HWU P;LAPOINTE R;ROSENBERG S;PARKHURST M; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbTSDOHAHS; | Immunogenec peptides of a melanoma antigen recognized by T cells, designated gp 100, bioassays using the peptides to diagnose, assess or prognose a mammal afflicted with cancer, more specificallly melanoma or metastatic melanoma, and use of the proteins and peptides as immunogens to inhibit, prevent or treat melanoma. | 2002 Aug 22 | 2003 Mar 6 |
| WO03022867 | PEPTIDES DERIVED FROM THE SUPERANTIGEN (SAG) ENV PROTEIN OF HERV-K18 AND THEIR USE IN OBTAINING SAG-INHIBITORY ANTIBODIES AND IN VACCINATION AGAINST SAG | DUPUIS M; | NOVIMMUNE SA; | The present invention relates to peptides derived from the superantigen (Sag) ENV protein of the human endogenous retrovirus HERV-K18, and to the use of the peptides in obtaining antibodies which inhibit the superantigen activity of HERV-K18 ENV. The invention also relates to vaccine compositions for treating and preventing disorders associated with the ENV gene product of HERV-K18, for example autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM). A preferred peptide consists of a portion of an N- or C-terminal segment of the HERV-K18.1 ENV protein, as illustrated in Figure 1A, said N-terminal segment extending from amino acids 22 to 62 of HERV-K18.1 ENV, and said C-terminal segment extending from amino acids 110 to 153 of HERV-K18.1 ENV, wherein the peptide has a length of 6 to 40 amino acids and is capable of giving rise to antibodies which inhibit superantigen activity associated with HERV-K18 envelope proteins | 2002 Sep 6 | 2003 Mar 20 |
| WO93008279 | T CELL EPITOPES OF THE MAJOR ALLERGENS FROM DERMATOPHAGOIDES (HOUSE DUST MITE) | Garman R;GREENSTEIN J;KUO MC;ROGERS B; | IMMULOGIC PHARMACEUTICAL CORPORATION; | The present invention provides isolated peptides of the major protein allergens of the genus Dermatophagoides. Peptides within the scope of the invention comprise at least one T cell epitope, or preferably at least two T cell epitopes of a protein allergen selected from the allergens Der p I, Der p II, Der f I, or Der f II. The invention also pertains to modified peptides having similar or enhanced therapeutic properties as the corresponding, naturally-occurring allergen or portion thereof, but having reduced side effects. The invention further provides nucleic acid sequences coding for peptides of the invention. Methods of treatment or of diagnosis of sensitivity to house dust mites in an individual and therapeutic compositions comprising one or more peptides of the invention are also provided | 1992 Oct 15 | 1993 Apr 29 |
| WO93008280 | RECOMBITOPE PEPTIDES | ROGERS B;MORGENSTERN J;BOND J;GARMAN R;KUO MC;MORVILLE M; | IMMULOGIC PHARMACEUTICAL CORPORATION; | The present invention provides peptides having T cell stimulating activity termed recombitope peptides. Recombitope peptides of the invention preferably comprise at least two T cell epitopes derived from the same or from different protein antigens, and preferably comprise at least two regions, each region preferably having human T cell stimulating activity and each region comprising at least one T cell epitope derived from a protein antigen. Recombitope peptides of the invention can be derived from protein allergens, autoantigens, or other protein antigens. The invention also provides methods of diagnosing sensitivity to a protein allergen or other protein antigen in an individual, methods to treat such sensitivity and therapeutic compositions comprising one or more recombitope peptides. The invention further provides methods for designing recombitope peptides of the invention where the protein antigen to which the individual is sensitive has unknown or ill-defined T cell epitopes | 1992 Oct 16 | 1993 Apr 29 |
| WO95026979 | CYTOTOXIC T-CELL LYMPHOCYTE ('CTL') ACTIVITY REGULATION BY CLASS I MHC PEPTIDES | CLAYBERGER C;KRENSKY A;PARHAM P; | THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY; | Fragments from the polymorphic domains of Class I HLA antigen domains are used to modulate T-cell activity. The peptides are from the 'alpha'1- or 'alpha'2-domains, particularly of the HLA-A, and B antigens. The peptides may be conjugated to other compounds to be used in diagnosis and therapy. The peptides may block lysis, CTL proliferation or have other regulating effects | 1995 Apr 5 | 1995 Oct 12 |
| WO96018409 | IN VIVO ACTIVATION OF TUMOR-SPECIFIC CYTOTOXIC T CELLS | SHERMAN L; | THE SCRIPPS RESEARCH INSTITUTE;SHERMAN L; | The present invention relates to methods, compositions, and peptides useful in activating CTLs in vivo with specificity for particular antigenic peptides. The invention also discloses the use of activated CTLs in vivo for the diagnosis and treatment of a variety of disease conditions, and compositions appropriate for these uses. Diagnostic systems, components, and methods are also described herein | 1995 Dec 14 | 1996 Jun 20 |
| WO96021673 | ISOLATED, TRUNCATED NUCLEIC ACID MOLECULES WHICH CODE FOR GAGE TUMOR REJECTION ANTIGEN | VAN DER BRUGGEN P;VAN DEN EYNDE B;DeBACKER O;BOON-FALLEUR T; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | A new family of tumor rejection antigen precursors, and the nucleic acid molecules which code for them, are disclosed. These tumor rejection antigen precursors are referred to as GAGE tumor rejection antigen precursors, and the nucleic acid molecules which code for them are referred to as GAGE coding molecules. Various diagnostic and therapeutic uses of the coding sequences and the tumor rejection antigens, and their precursor molecules are described. Tumor rejection antigens are also shown | 1996 Jan 11 | 1996 Jul 18 |
| WO97005168 | THE H-Y ANTIGEN | GOULMY E;HUNT D;ENGELHARD V; | RIJKSUNIVERSITEIT TE LEID; | H-Y is a transplantation antigen that can lead to rejection of HLA-matched male organ and bone marrow grafts by female recipients, and may play a role in pregnancy and spermatogenesis. However, the origin and function of H-Y antigens has eluded researchers for 40 years. We show that one human H-Y peptide antigen presented by HLA-B7 is an 11 residue peptide derived from SMCY, an evolutionarily conserved Y chromosomal protein. A homologous gene on the X chromosome, SMCX, differs by two residues in the same region. We also show a peptide antigen recognized by two HLA-A2.1 restricted T cell clones, which is also encoded by SMCY. The identification of H-Y offers prospects for improvements in transplantation outcome, prenatal diagnosis and fertilization strategies | 1996 Jul 29 | 1997 Feb 13 |
| WO97040068 | NOVEL PEPTIDES SUITABLE FOR USE IN ANTIGEN SPECIFIC IMMUNOSUPPRESSIVE THERAPY | BOOTS A;VERHEIJDEN G; | AKZO NOBEL NV; | The invention relates to peptides consisting of 16 to 55 amino acid residues, said peptides comprising at least one of the amino acid sequences LVCYYTSWS (SEQ ID NO:60), FLCTHIIYS (SEQ ID NO:61), IIYSFANIS (SEQ ID NO:62), LKTLLSVGG (SEQ ID NO:63), FIKSVPPFL (SEQ ID NO:64), FDGLDLAWL (SEQ ID NO:65), LYPGRRDKQ (SEQ ID NO:66), YDIAKISQH (SEQ ID NO:67), LDFISIMTY (SEQ ID NO:68), FISIMTYDF (SEQ ID NO:69), FRGQEDASP (SEQ ID NO:70), YAVGYMLRL (SEQ ID NO:71), MLRLGAPAS (SEQ ID NO:72), LAYYEICDF (SEQ ID NO:73), LRGATVHRT (SEQ ID NO:74), YLKDRQLAG (SEQ ID NO:75), LAGAMVWAL (SEQ ID NO:76), VWALDLDDF (SEQ ID NO:77) or LDLDDFQGS (SEQ ID NO:78). The peptides can be used in the treatment of T-cell mediated destruction of articular cartilage. Administration of pharmaceutical compositions based on these peptides can be used to induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells | 1997 Apr 22 | 1997 Oct 30 |
| WO97040156 | MUTATED RAS PEPTIDES FOR GENERATION OF CD8+ CYTOTOXIC T LYMPHOCYTES | SCHLOM J;ABRAMS S; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbTSDOHAHS; | Mutant ras oncogene peptides may induce specific ant-ras cellular immune responses in vaccinated patients. Moreover, a human CD8+ CTL epitope(s) reflecting a specific point mutation in the K-ras oncogene at codon 12 was identified. The mutant ras peptide has implications for both active and passive immunotherapies in selected carcinoma patients. A nested 10-mer peptide was identified [i.e., ras5-14(Asp12)], which was shown to bind to HLA-A2 and display specific functional capacity for expansion of the in-vivo-primed CD8+ CTL precursors | 1997 Apr 17 | 1997 Oct 30 |
| WO99002550 | CTL EPITOPES FROM EBV | BURROWS S;KHANNA R; | SHERRITT M; | The present invention provides cytotoxic Epstein-Barr virus (EBV) T-cell epitopes derived from EBV structural antigens. Preferred epitopes include YLLEMLWRL (SEQ ID NO:1), YFLEILWGL (SEQ ID NO:32), YLLEILWRL (SEQ ID NO:33), YLQQNWWTL (SEQ ID NO:6), LLLALLFWL (SEQ ID NO:2), LLVDLLWLL (SEQ ID NO:3), LLLIALWNL (SEQ ID NO:4), WLLLFLAIL (SEQ ID NO:5), TLLVDLLWL (SEQ ID NO:7), LLWLLLFLA (SEQ ID NO:8), ILLIIALYL (SEQ ID NO:9), VLFIFGCLL (SEQ ID NO:10), RLGATIWQL (SEQ ID NO:11), ILYFIAFAL (SEQ ID NO:15), SLVIVTTFV (SEQ ID NO:17), LMIIPLINV (SEQ ID NO:20), TLFIGSHVV (SEQ ID NO:24), LIPETVPYI (SEQ ID NO:26), VLQWASLAV (SEQ ID NO:27) and QLTPHTKAV (SEQ ID NO:29). The present invention also provides methods of treating or preventing EBV infection in subjects which involve administration of EBV cytotoxic T-cell epitopes | 1998 Jul 10 | 1999 Jan 21 |
| WO99004265 | CANCER ASSOCIATED NUCLEIC ACIDS AND POLYPEPTIDES | OLD L;SCANLAN M;STOCKERT E;GURE A;CHEN YT;GOUT I;O'HARE M;OBATA Y;PFREUNDSCHUH M;TURECI O;SAHIN U; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | Tumor cell-specific antigens from melanoma cells have previously been identified using autologous cytolytic T cells clones from the patient, but the same approach did not work well with other tumour types. Here, screening of such antigens was successfully performed using antisera from the patient. Provided are several tumor cell-specific antigens, nucleic acids encoding them, antibodies and CTL's directed against these antigens, antigenic fragments diagnostic kits, etc | 1998 Jul 15 | 1999 Jan 28 |
| WO99005173 | THE HA.ndash.1 ANTIGEN | GOULMY EAJM;HUNT D;ENGELHARD V; | RIJKSUNIVERSITEIT TE LEID; | The present invention discloses the peptide sequence of a so-called minor H antigen. The minor H antigens are associated with the Graft versus Host Disease. The peptide and its derivatives find many uses in bone marrow transplantation, organ transplantation and in the treatment of leukemia. The peptide and its derivatives can be incorporated in vaccines, in pharmaceutical formulations and they can be used in diagnostic test kits. The peptide is derived from the HA-1 minor antigen and has the sequence VLXDDLLEA, wherein X represents a histidine or an arginine residue. Both donors and recipients in bone marrow transplantation can be treated with the peptides, optionally in combination with other peptides, coupled to carriers, with suitable excipients and/or adjuvants | 1998 Jul 23 | 1999 Feb 4 |
| WO99019478 | AGONIST AND ANTAGONIST PEPTIDES OF CARCINOEMBRYONIC ANTIGEN (CEA) | SCHLOM J;BARZAGA E;ZAREMBA S; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbTSDOHAHS; | The present invention relates to the preparation and use of peptides that act as agonists and antagonists of human carcinoembryonic antigen (CEA). Agonists of the CEA peptide, CAP1, are disclosed and their utility in enhancing immune responses against CEA demonstrated | 1998 Sep 22 | 1999 Apr 22 |
| WO99053938 | ISOLATED PEPTIDES CORRESPONDING TO AMINO ACID SEQUENCES OF NY.ndash.ESO.ndash.1, WHEREIN BIND TO MHC CLASS I AND MHC CLASS II MOLECULES, AND USES THEREOF | STOCKERT E;JAGER E;CHEN Yt;SCANLAN M;ALEXANDER K;OLD L;GURE A;RITTER G; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention relates to peptides which bind to MHC Class I and to MHC Class II molecules. These peptides are useful in different therapeutic and diagnostic contexts | 1999 Mar 24 | 1999 Oct 28 |
| WO99061065 | CD40 BINDING MOLECULES AND CTL PEPTIDES FOR TREATING TUMORS | MELIEF C;OFFRINGA R;TOES R;SCHOENBERGER S;DE BOER M; | TANOX I; | Disclosed is a method and composition for treating tumors or infectious diseases, wherein the composition includes CD40 binding molecules together with CTL-activating peptides, e.g., tumor antigens. Such compostion is useful for enhancing the anti-tumor affect of a peptide tumor vaccine, or for otherwise activating CTLs so that the activated CTLs can act against tumurous or infected cells. The CD40 binding molecules can include antibody molecules, as well as homologues, analogues and modified or derived forms thereof, including immunoglobulin fragments like Fab, (Fab')2 and Fv, as well as other molecules including peptides, oligonucleotides, peptidomimetics and organic compounds which bind to CD40 and activate the CTL response | 1999 May 21 | 1999 Dec 2 |
| WO99066952 | ARTIFICIAL T HELPER CELL EPITOPES AS IMMUNE STIMULATORS FOR SYNTHETIC PEPTIDE IMMUNOGENS INCLUDING IMMUNOGENIC LHRH PEPTIDES | WANG C; | UNITED BIOMEDICAL INC.; | The present invention is directed to novel peptide immunogens for eliciting antibodies to LHRH comprising artificial T helper cell epitopes (Th epitopes) designed to provide optimum immunogenicity. The artificial Th epitopes are covalently linked to LHRH and optionally an immunostimulatory sequence | 1999 Jun 21 | 1999 Dec 29 |
| WO01016183 | MONOCLONAL ANTIBODIES AND VACCINES AGAINST EPITOPES ON THE EBOLA VIRUS GLYCOPROTEIN | HART M;WILSON J;SCHMALJOHN A;HART M;WILSON J;SCHMALJOHN A; | U.S.ARMY MEDICAL RESEARCH INSTITUTE OF INFECTIOUS DISEASES;U.S.ARMY MEDICAL RESEARCH INSTITUTE OF INFECTIOUS DISEASES;HART M;WILSON J;SCHMALJOHN A; | In this application are described Ebola GP monoclonal antibodies and epitopes recognized by these monoclonal antibodies. Also provided are mixtures of antibodies of the present invention, as well as methods of using individual antibodies or mixtures thereof for the detection, prevention, and/or therapeutical threatment of Ebola virus infections in vitro and in vivo | 2000 Aug 29 | 2001 Mar 8 |
| WO01023414 | IMMUNOLOGICALLY SIGNIFICANT HERPES SIMPLEX VIRUS ANTIGENS AND METHODS FOR IDENTIFYING AND USING SAME | KOELLE D;CHEN H;COREY L;HOSKEN N;MCGOWAN P;FLING S;POSAVAD C; | UNIVERSITY OF WASHINGTON;CORIXA CORPORATION;FRED HUTCHINSON CANCER RESEARCH CENTER; | The invention provides HSV antigens that are useful for the prevention and treatment of HSV infection. Disclosed herein are epitopes confirmed to be recognised by T-cells derived from herpetic lesions. T-cells having specificity for antigens of the invention have demonstrated cytotoxic activity against cells loaded with virally-encoded peptide epitopes, and in many cases, against cells infected with HSV. The identification of immunogenic antigens responsible for T-cell specificity provides improved anti-viral therapeutic and prophylactic strategies. Compositions containing antigens or polynucleotides encoding antigens of the invention provide effectively targeted vaccines for prevention and treatment of HSV infection | 2000 Sep 28 | 2001 Apr 5 |
| WO01045639 | METHODS FOR PROTECTING AGAINST LETHAL INFECTION WITH BACILLUS ANTHRACIS | GALLOWAY DARR;MATECZUN ALFR; | THE OHIO STATE UNIVERSITY RESEARCH FOUNDATION;GALLOWAY D;MATECZUN A; | Methods of inducing an immune response which protects a susceptible animal subject from lethal infection with Bacillus anthracis (B. anthracis) are provided. One method comprises administering an effective amount of wild-type, or preferably a mutated form of, B. anthracis lethal factor (LF) or an immunogenic fragment thereof to the subject. A second method comprises administering an effective amount of a mutated LF protein or an immunogenic fragment of an LF protein and an effective amount of the B. anthracis protective antigen (PA) or an immunogenic fragment of the PA protein to the subject. A third method comprises administering a polynucleotide or nucleic acid comprising a sequence encoding a mutated B. anthracis LF protein or an immunogenic fragment of an LF protein to the subject. A fourth method comprises administering a polynucleotide which comprises a coding sequence for a mutated LF protein or an immunogenic fragment of an LF protein and a polynucleotide which comprises a coding sequence for the B. anthracis PA protein or an immunogenic fragment thereof to the subject. The present invention also relates to a protein or peptide based-immunogenic composition for preparing a vaccine which is capable of prophylactically protecting a subject against lethal effects of infection with B. anthracis or exposure to a toxic agent which is produced by B. anthracis. The protein or peptide based immunogenic composition comprises a purified or recombinant LF protein or immunogenic fragment thereof and a purified or recombinant PA protein or immunogenic fragment thereof. The present invention also relates to a nucleic acid-based immunogenic composition comprising a nucleic acid which comprises a sequence encoding the LF protein or an immunogenic fragment thereof and a polynucleotide which comprises a sequence encoding the PA protein or an immunogenic fragment thereof | 2000 Dec 21 | 2001 Jun 28 |
| WO01083561 | ANTHRAX SPECIFIC ANTIBODIES | MANGOLD B;ALDRICH J;O'BRIEN T; | TETRACORE LLC; | The present invention is directed to diagnostic tools and therapies using antibodies to Bacilus anthracis. Specifically, the present invention is directed to a B. anthracis-specific monoclonal antibody that binds to the EA1 antigen (corresponding to the eag gene) of the S-layer (surface layer) of spores. This monoclonal antibody may be used in a variety of applications, including to specifically detect and diagnose B. anthracis. Preferably, antibodies are monoclonal and bind to a surface protein, such as EA1 protein, on the spores of B. anthracis, and not to spores of either B. cereusor B. thuringiensis. Antibodies can be incorporated into detection kits using, for example, colloidal particle based lateral flow detection system. Such detection kits can distinguish anthrax spores from non-pathogenic varieties of spores. In addition, the invention is directed to B. anthracis EA1 antigen and pharmaceuticals such as vaccines that can be used as therapeutics and to develop improved antibodies and detection methods | 2001 Apr 30 | 2001 Nov 8 |
| WO02020035 | HLA BINDING PEPTIDES AND THEIR USES | SETTE A;SIDNEY J;SOUTHWOOD S; | EPIMMUNE INC.; | The present invention provides peptide compositions capable of binding glycoproteins encoded by HLA, HLA-B, and HLA-C alleles and inducing T cell activation in T cells restricted by the HLA allele. The peptides are useful to elicit an immune response against a desired antigen | 2000 Sep 1 | 2002 Mar 14 |
| WO04011650 | ALTERNATIVE READING FRAME ANTIGENS FROM VIRUSES | MATTNER F;SCHMIDT W;HABEL A; | INTERCELL AG; | The invention discloses polypeptides encoded by an alternative reading frame of a pathogenic virus, which polypeptides - start with a methionine amino acid residue, - comprise an antigenic determinant and - comprise more than 7 amino acid residues and fragments of said polypeptides comprising more than 7 amino acids | 2003 Jul 24 | 2004 Feb 5 |
| WO04032622 | PRODUCTION OF PEPTIDES IN PLANTS AS VIRAL COAT PROTEIN FUSIONS | PALMER KE;TOTH RL;JONES M;CHAPMAN S;SMOLENSKA L;MCCORMICK A;POGUE G;NGUYEN L; | LARGE SCALE BIOLOGY CORPORATION; | Vaccines and diagnostic composition are made and used for preventing, treating and detecting antigens from a papilloma virus, ebola virus, HIV virus, Rift Valley Fever virus or a parvovirus. The epitopes of these viruses are produced as genetically engineered fusion peptides in plants by infection with a recombinant tobamovirus vectors to express fusion proteins containing the epitope peptides | 2003 Sep 3 | 2004 Apr 22 |
| WO95024924 | COMPOSITIONS AND METHODS FOR VACCINES COMPRISING 'alpha'-GALACTOSYL EPITOPES | GALILI U;REPIK P; | MEDICAL COLLEGE OF PENNSYLVANIA AND HAHNEMANN UNIVERSITY;GALILI U;REPIK P; | The invention encompasses methods and compositions for inducing an immune response in an anti-Gal synthesizing animal including viral and tumor antigens manipulated to express 'alpha'-galactosyl epitopes | 1995 Mar 13 | 1995 Sep 21 |
| WO97028819 | VACCINE AGAINST HANTAVIRUS | LUNDKVIST A; | SBL VACCIN AB; | Virus vaccine against Hantaviruses, especially Puumala virus, which comprises, an immunizing component, at least one member of the group consisting of: a) a recombinant protein having the amino-acid sequence of the figure; b) fragments of said protein which comprise B-cell and/or T-cell epitopes; and c) amino-acid sequences which are at least 80 0mologous to the sequences of a) or b) and which comprise B-cell and/or T-cell epitopes, are disclosed | 1997 Feb 6 | 1997 Aug 14 |
| WO03011893 | IMMUNOLOGICALLY SIGNIFICANT HERPES SIMPLEX VIRUS ANTIGENS AND METHODS FOR USING SAME | KOELLE D;HOSKEN N; | UNIVERSITY OF WASHINGTON;CORIXA CORPORATION; | The invention provides HSV antigen that are useful for the prevention and treatment of HSV infection. Disclosed herein are epitopes confirmed to be recognized by T-cells derived from herpetic lesions. T-cells having specificity for antigens of the invention have demonstrated cytotoxic activity against cells loaded with virally-encoded peptide epitopes, and in many cases, against cells infected with HSV. The identification of immunogenic antigens responsible for T-cell specificity provides improved anti-viral therapeutic and prophylactic strategies. Compositions containing antigens or polynucleotides encoding antigens of the invention provide effectively targeted vaccines for prevention and treatments of HSV infection | 2002 Jul 31 | 2003 Feb 13 |
| WO03013431 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF BREAST CANCER | FANGER G;HIRST S;DILLON D;FOY T;HOUGHTON R;PERSING D;KALOS M; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly breast cancer, are disclosed. Illustrative compositions comprise one or more breast tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly breast cancer | 2002 Aug 5 | 2003 Feb 20 |
| WO03020108 | COMPOSITIONS AND METHODS FOR THE DIAGNOSIS AND TREATMENT OF HERPES SIMPLEX VIRUS INFECTION | HOSKEN N;DAY C; | CORIXA CORPORATION; | Compounds and methods for the diagnosis and treatment of HSV infection are provided. The compounds comprise polypeptides that contain at least one antigenic portion of an HSV polypeptide and DNA sequences encoding such polypeptides. Pharmaceutical compositions and vaccines comprising such polypeptides or DNA sequences are also provided, together with antibodies directed against such polypeptides. Diagnostic kits are also provided comprising such polypeptides and/or DNA sequences and a suitable detection reagent for the detection of HSV infection in patients and in biological samples | 2002 Aug 27 | 2003 Mar 13 |
| WO03029279 | IMMUNODOMINANT ACETYLCHOLINE RECEPTOR ALPHA SUBUNIT PEPTIDE: MHC COMPLEXES | SPACK E;ARMILLI S;DESHPANDE S;WEHNER N; | CORIXA CORPORATION; | The present invention is directed to the treatment of autoimmune diseases, in particular of myasthenia gravis. This invention provides novel autoimmune dominant peptides derived from the acetylcholine receptor, as well as methods for preparing the peptides. The present invention further provides complexes comprising these peptides associated with an appropriate major histocompatibility complex (MHC) molecule and methods for making these complexes. The complexes of the present invention can be used therapeutically or prophylactically for treating myasthenia gravis | 2002 Oct 2 | 2003 Apr 10 |
| WO03037060 | COMPOSITIONS AND METHODS FOR WT1 SPECIFIC IMMUNOTHERAPY | MCNEILL P;JAYA N;CARTER D; | CORIXA CORPORATION;GAIGER A; | Compositions and methods for the therapy of malignant diseases, such as leukemia and cancer, are disclosed. The compositions comprise one or more of a WT1 polynucleotide, a WT1 polypeptide, an antigen-presenting cell presenting a WT1 polypeptide, an antibody that specifically binds to a WT1 polypeptide; or a T cell that specifically reacts with a WT1 polypeptide. Such compositions may be used, for example, for the prevention and treatment of metastatic diseases | 2002 Oct 30 | 2003 May 8 |
| WO03037267 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER | HENDERSON R;WANG T;WATANABE Y;KALOS M;SLEATH P;JOHNSON J;RETTER M;DURHAM M;CARTER D;FANGER G;VEDVICK T;BANGUR C;MCNABB A; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer | 2002 Oct 28 | 2003 May 8 |
| WO03040165 | HLA CLASS I AND II BINDING PEPTIDES AND THEIR USES | SETTE A;SIDNEY J;SOUTHWOOD S; | EPIMMUNE INC.; | The present invention provides the means and methods for selecting immunogenic peptides and the immunogenic peptide compositions capable of specifically binding glycoproteins encoded by HLA alleles and inducing T cell activation in T cells restricted by the allele. The peptides are useful to elicit an immune response against a desired antigen | 2001 Oct 18 | 2003 May 15 |
| WO03082317 | PEPTIDE EPITOPES RECOGNIZED BY ANTIGEN SPECIFIC CD8+ T LYMPHOCYTES | CHICZ R;TOMLINSON A; | ZYCOS I;AVENTIS PASTEUR I; | The invention provides methods for identifying and validating epitopes that are bound to class I MHC molecules and activate CD8+ T cells involved in the pathogenesis of or protection from diseases, e.g., cancers. The invention includes peptide epitopes derived from the CEA polypeptide by such methods, and methods of therapeutic use of these epitopes against diseases such as cancers | 2003 Mar 20 | 2003 Oct 9 |
| WO03086175 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER | MERICLE B;FANGER G;VEDVICK T;CARTER D;WATANABE Y;HENDERSON R;KALOS M;SPIES G;FOY T;FAN L;WANG T;MCNABB A;REED S; | CORIXA CORPORATION; | Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer | 2003 Apr 7 | 2003 Oct 23 |
| WO03086308 | COMPOSITIONS AND METHODS FOR THE DIAGNOSIS AND TREATMENT OF HERPES SIMPLEX VIRUS INFECTION | DAY C;HOSKEN N;PARSONS J; | CORIXA CORPORATION; | Compounds and methods for the diagnosis and treatment of HSV infection are provided. The compounds comprise polypeptides that contain at least one antigenic portion of an HSV polypeptide and DNA sequences encoding such polypeptides. Pharmaceutical compositions and vaccines comprising such polypeptides or DNA sequences are also provided, together with antibodies directed against such polypeptides. Diagnostic kits are also provided comprising such polypeptides and/or DNA sequences and a suitable detection reagent for the detection of HSV infection in patients and in biological samples | 2003 Apr 9 | 2003 Oct 23 |
| WO03087126 | HETEROCLITIC ANALOGS AND RELATED METHODS | ISHIOKA G;FIKES J;TANGRI S;SETTE A; | EPIMMUNE INC.; | Heteroclitic analogs of class I epitopes are prepared by providing convervative, semi-conservative, or non-conservative amino acid substitutions at positions 3 and/or 4 and/or 5 and/or 6 and/or 7 and/or 8 and/or 9 and/or 10 of these epitopes. The analogs are useful in eliciting immune responses with respect to the corresponding wild-type epitopes | 2003 Apr 7 | 2003 Oct 23 |
| WO00010013 | COMPOSITION, FORMULAE, DEVICES AND METHODS FOR CONTROL OF SPECIFICITY AND INCLUSIVITY OF MICROORGANISMS CONTAINING CLOSELY RELATED ANTIGEN EPITOPES | FELDSINE P;KERR D;ZHU P;MUI L; | BIOCONTROL SYSTEMS I; | Compositions, formulae, devices and methods for the detection of target microorganisms, such as by visual immunoprecipitate assay, enzyme linked immunoassay, chemiluminescence, immunoblotting, or similar detection technology, wherein detection requires the discrimination among closely related genera, species and strains of antigenically related microorganisms based on immunological reactivity of a highly conserved antigen epitopes with a reagent system comprised of an antibody linked to a detecting reagent. The invention permits a detectable event to occur by exposing inaccessible but highly conserved and specific antigen epitopes to the detecting reagent. Exposure of such antigen epitopes without inactivating microbial metabolism allows for specific detection | 1999 Aug 13 | 2000 Feb 24 |
| WO00011186 | MODIFIED HCV PEPTIDE VACCINES | BERZOFSKY J;SAROBE P;PENDLETON C;FEINSTONE S;ARICHI T;MAJOR M; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA arbTSDOHAHS; | The present invention provides 1) an isolated peptide having the amino acid sequence DLMGYIPAV, (SEQ ID NO: 1); 2) an isolated HCV core polypeptide comprising an L\Ararr;A substitution at amino acid position 139; 3) an isolated HCV core polypeptide having the amino acid sequence of SEQ ID NO: 2; and 4) a fragment of an HCV core polypeptide having fewer amino acids than the entire HCV core polypeptide and comprising the amino acid sequence SEQ ID NO: 1. Also provided are nucleic acids which encode the peptides and polypeptides of this invention, vectors comprising the nucleic acids of this invention and cells comprising the vectors and nucleic acids of this invention. The present invention further provides methods of producing an immune response in a subject and/or treating or preventing HCV infection in a subject, comprising administering to the subject, or to a cell of the subject, any of the compositions of this invention | 1999 Aug 17 | 2000 Mar 2 |
| WO00012547 | BENZODIAZEPINES AND BENZOTHIAZEPINES DERIVATIVES AND HBSAG PEPTIDES BINDING TO ANNEXINS, THEIR COMPOSITIONS AND USE | DEPLA E;MOEREELS H;MAERTENS G; | INNOGENETICS NV; | The present invention relates to 1,4-benzodiazepines or 1,4-benzothiazepines derivatized with a peptide that can inhibit the interaction between annexin and annexin binding proteins. In particular, the present invention relates to 1,4-benzodiazepines or 1,4-benzothiazepines derivatives that can inhibit the interaction between annexin and viral proteins that bind annexins such as the HBaAg protein of HBV, glycoprotein B of the cytomegalovirus or any annexin binding protein from the influenza virus. These 1,4-benzodiazepines or 1,4-benzothiazepines derivates can be used to prevent or treat diseases in which interactions between annexin family members and annexin binding proteins are involved such as HBV and/or HBV infections, cytomegalovirus infections or influenza virus infections. The invention also relates to annexin binding epitopes from HBsAg and their use in the treatment of viral infections | 1999 Aug 25 | 2000 Mar 9 |
| WO00026385 | NUCLEIC ACID CONSTRUCTS FOR GENETIC IMMUNIZATION | FULLER D;FULLER J; | POWDERJECT VACCINES I; | Recombinant nucleic acid molecules are described. The molecules have a first sequence encoding a Hepatitis B virus core antigen and a second sequence encoding at least one T cell epitope inserted within the first sequence. Vectors and compositions containing these molecules are also described. Methods of eliciting an immune response using these molecules are also described | 1999 Nov 5 | 2000 May 11 |
| WO00032228 | PEPTIDE.ndash.BASED VACCINE FOR INFLUENZA | ARNON R;BEN YEDIDIA T;LEVI R; | YEDA RESEARCH AND DEVELOPMENT CO.LTD.; | A human synthetic peptide-based influenza vaccine for intranasal administration comprises a mixture of flagella containing at least four epitopes of influenza virus reactive with human cells, each expressed individually in i(Salmonella) flagellin, said influenza virus epitopes being selected from the group consisting of: (i) one B-cell hemagglutinin (HA) epitope; (ii) one T-helper hemagglutinin (HA) or nucleo-protein (NP) epitope that can bind to many HLA molecules; and (iii) at least two cytotoxic lymphocyte (CTL) nucleoprotein (NP) or matrix protein (M) epitopes that are restricted to the most prevalent HLA molecules in different human populations | 1999 Nov 28 | 2000 Jun 8 |
| WO00040261 | VACCINATION METHOD FOR EFFICIENT INDUCTION OF CYTOTOXIC T LYMPHOCYTE RESPONSE | WATKINS D;ALLEN T;VOGEL T;FULLER D;FULLER J; | POWDERJECT VACCINES I; | A method for inducing an epitope-specific cytotoxic lymphocyte response in primates is disclosed. The method involves delivering a DNA-based vaccine that encodes an MHC class I epitope and a polyepitope and an MHC class I epitope and the hepatitis B core antigen into the primate, followed by delivering a modified virus vaccine that encodes an MHC class I epitope and a polyepitope into the primate | 2000 Jan 6 | 2000 Jul 13 |
| WO00050460 | EPITOPES OR MIMOTOPES DERIVED FROM THE C.ndash.EPSILON.ndash.2 DOMAIN OF IGE, ANTAGONISTS THEREOF, AND THEIR THERAPEUTIC USES | DYSON M;FRIEDE M;GREENWOOD J;HEWITT E;LAMONT A;MASON S;RANDALL R;TURNELL W;VAN MECHELEN M;VINALS YDB; | PEPTIDE THERAPEUTICS LIMITED; | The present invention relates to the provision of novel medicaments for the treatment, prevention or amelioration of allergic disease. In particular, the novel medicaments are isolated peptides incorporating epitopes or mimotopes of surface exposed regions of the C\Aepsi;2 domain of IgE. The inventors have found that these novel regions may be the target for both passive and active immunoprophylaxis or immunotherapy. The invention further relates to methods for production of the medicaments, pharmaceutical compositions containing them and their use in medicine. Also forming an aspect of the present invention are ligands, especially monoclonal antibodies, which are capable of binding the surface exposed IgE regions of the present invention, and their use in medicine as passive immunotherapy or in immunoprophylaxis | 2000 Feb 22 | 2000 Aug 31 |
| WO00050461 | EPITOPES OR MIMOTOPES DERIVED FROM THE C.ndash.EPSILON.ndash.3 OR C.ndash.EPSILON.ndash.4 DOMAINS OF IGE, ANTAGONISTS THEREOF, AND THEIR THERAPEUTIC USES | FRIEDE M;MASON S;TURNELL W;VAN MECHELEN M;VINALS YDB; | PEPTIDE THERAPEUTICS LIMITED; | The present invention relates to the provision of novel medicaments for the treatment, prevention or amelioration of allergic disease. In particular, the novel medicaments are epitopes or mimotopes derived from the C\Aepsi;3 or C\Aepsi;4 domains of IgE. These novel regions may be the target for both passive and active immunoprophylaxis or immunotherapy. The invention further relates to methods for production of the medicaments, pharmaceutical compositions containing them and their use in medicine. Also forming an aspect of the present invention are ligands, especially monoclonal antibodies, which are capable of binding the IgE regions of the present invention, and their use in medicine as passive immunotherapy or immunoprophylaxis | 2000 Feb 22 | 2000 Aug 31 |
| WO00063702 | PEPTIDE EPITOPES RECOGNIZED BY DISEASE PROMOTING CD4+ T LYMPHOCYTES | PEAKMAN M;CHICZ R; | KING'S COLLEGE LONDON; | The invention provides methods for identifying peptide epitopes that activate CD4+ T cells involved in the pathogenesis of diseases, e.g., autoimmune diseases, susceptibility to which is determined by expression of particular class II MHC genes. The invention includes peptides derived from the IA-2 polypeptide by such a method, altered peptide ligands, and methods of therapy involving the use of altered peptide ligands | 2000 Apr 20 | 2000 Oct 26 |
| WO00078995 | DETECTION OF SALMONELLA ENTERITIDIS | KWANG HS;LIU W;LOW SS;LOH K; | INSTITUTE OF MOLECULAR AGROBIOLOGY; | A method for detecting \Alt;i\Agt;Salmonella enteritidis\Alt;/i\Agt; in poultry and their eggs comprises contacting a biological sample obtained from poultry suspected of containing \Alt;i\Agt;S. enteritidis\Alt;/i\Agt; with a fragment of a \Alt;i\Agt;S. enteritidis\Alt;/i\Agt; fimbrial protein or a fragment of a \Alt;i\Agt;S. enteritidis\Alt;/i\Agt; flagellin protein which specifically recognizes \Alt;i\Agt;S. enteritidis\Alt;/i\Agt; antibodies present in the sample and discriminates between \Alt;i\Agt;S. enteritidis\Alt;/i\Agt; and other \Alt;i\Agt;Salmonella spp\Alt;/i\Agt; | 1999 Jun 22 | 2000 Dec 28 |
| WO01000225 | HLA BINDING PEPTIDES AND THEIR USES | SETTE A;SIDNEY J;SOUTHWOOD S; | EPIMMUNE INC.; | The present invention provides the means and methods for selecting immunogenic peptides and the immunogenic peptide compositions capable of specifically binding glycoproteins encoded by HLA alleles and inducing T cell activation in T cells restricted by the allele. The peptides are useful to elicit an immune response against a desired antigen | 2000 Jun 28 | 2001 Jan 4 |
| WO01004149 | ANTIGENIC EPITOPES AND MOSAIC POLYPEPTIDES OF HEPATITIS C VIRUS PROTEINS | FIELDS H;KHUDYAKOV Y; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA arbTSDOHAHS; | Antigenic epitopes of hepatitis C virus (HCV) and mosaic HCV polypeptides useful as reagents in assays for the diagnosis or monitoring of HCV in a biological sample. The antigenic epitopes and mosaic polypeptides are also useful for the construction of immunogenic pharmaceutical compositions, such as vaccines. The mosaic polypeptides are artificial composite proteins constructed from diagnostically relevant antigenic regions derived from different HCV proteins. Preferably, the mosaic polypeptides contain antigenic epitopes from the core protein, NS3 protein, and NS4 protein. The preferred mosaic polypeptides optionally contain an additional antigenic epitope from either the NS4 protein or the NS5a protein or both | 2000 Jul 7 | 2001 Jan 18 |
| WO01005824 | SYNTHETIC PEPTIDES IMMUNOREACTIVE WITH HEPATITIS A VIRUS ANTIBODIES | FIELDS H;KHUDYAKOV Y; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA arbTSDOHAHS; | Synthetic peptides immunoreactive with hepatitis A virus (HAV) antibodies are provided. The peptides are useful as laboratory reagents to detect or quantify HAV antibodies in biological samples in clinical or research-based assays and for inducing an immune response to HAV when administered to a human or animal. The peptides contain antigenic epitopes, modified antigenic epitopes or combinations of epitopes of the major structural capsid polypeptides or non-structural polypeptides of HAV and contain one or more molecules of the amino acid glutamine (Q) at the carboxyl end of the peptide, which enhances immunoreactivity and immunogenicity, particularly IgM antibody reactivity | 2000 Jul 14 | 2001 Jan 25 |
| WO01016174 | INDUCTION OF CYTOTOXIC T LYMPHOCYTE RESPONSE BY HLA CLASS IA RESTRICTED EPITOPES OF MYCOBACTERIAL HEAT SHOCK PROTEIN 65 | KIESSLING R;CHARO J;OTENHOFF T;GELUK A; | KIESSLING R;CHARO J;OTENHOFF T;GELUK A; | The induction of HLA-A*0201 restricted CD8+ T cell responses against an immunodominant and highly conserved antigen of mycobacteria (hsp65) in HLA-A*0201/Kb (A2/Kb) transgenic mice and humans is disclosed. At least six high affinity HLA-A*0201 binding CTL epitopes are described, one of which appears to be identical in a large number of pathogenic bacteria, and is recognized in a CD8 independent fashion. This peptide induces CD8+ T cells both in humans and in HLA-A*0201/Kb transgenic mice, which respond to the mycobacterial hsp65 epitope pulsed target or BCG infected macrophages but not to un-infected macrophages or to the same target pulsed with the corresponding human hsp65 homologue. The mycobacterial hsp65 epitope is generated efficiently, whereas the human hsp65 homologue fails to be processed, thus avoiding induction of autoreactivity. Thus, herein described are high affinity HLA class I binding epitopes that are naturally processed and are recognized efficiently by HLA class I restricted CD8 T cells thereby affording sub-unit vaccines against tuberculosis and other infectious diseases | 2000 Aug 30 | 2001 Mar 8 |
| WO01019408 | NUCLEIC ACIDS ENCODING POLYEPITOPE POLYPEPTIDES | HEDLEY M;URBAN R;CHICZ R;HEDLEY M;URBAN R;CHICZ R; | ZYCOS INC.;ZYCOS INC.;HEDLEY M;URBAN R;CHICZ R; | The invention provides nucleic acids encoding polyepitope polypeptides containing multiple epitopes from one or more proteins. The polyepitope polypeptides are useful as treatments for pathogenic agents or tumors | 2000 Sep 18 | 2001 Mar 22 |
| WO01022916 | NOVEL HEV ANTIGENIC PEPTIDE AND METHODS | NG M;IM S;ZHANG JZ; | THE UNIVERSITY OF HONG KONG;NG M;IM S;ZHANG JZ; | A highly immunoreactive viral peptide, pE2, is disclosed which is derived form the carboxy-terminal end region of ORF2 region of the hepatitis E virus (HEV) genome. A unique feature of the novel pE2 peptide is that it possesses conformational antigenic determinants which are only exposed when monomers of the peptide associate with one another through non-covalent interactions to naturally form homodimers. The novel pE2 peptide is proven to be highly reactive with sera from patients having current or past infection with HEV which suggests that the homodimer may mimic certain structural features of the HEV capsid protein. Furthermore, the antigenic activity of the pE2 peptide is strictly conformational in nature and therefore, exhibits immunochemical reactivity only when the peptide exists in a dimeric form. Consequently, the antigenic activity is lost upon dissociation of the dimers, but the activity is restored when the monomers reassociate to form dimers. Moreover, diagnostic methods useful in detecting and diagnosing HEV infection, and the use of a vaccine composition effective in preventing hepatitis E virus infection in which the novel pE2 peptide is utilized are also disclosed | 2000 Sep 28 | 2001 Apr 5 |
| WO01040270 | A MAJOR NEUTRALIZATION SITE OF HEPATITIS E VIRUS AND USE OF THIS NEUTRALIZATION SITE IN METHODS OF VACCINATION AND IN METHODS OF SCREENING FOR NEUTRALIZING ANTIBODIES TO HEPATITIS E VIRUS | SCHOFIELD D;EMERSON S;PURCELL R; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA as represented by THE SECRETARY DOHAHS; | The invention describes the identification of major neutralization site of hepatitis E virus (HEV) and the use of this neutralization site in methods of vaccination and in methods of screening for neutralizing antibodies to HEV. The invention also describes the isolation and characterization of neutralizing chimpanzee monoclonal antibodies reactive to the neutralization site and the use of these antibodies in the diagnosis, treatment and prevention of HEV | 2000 Nov 30 | 2001 Jun 7 |
| WO01060391 | A UNIVERSAL VACCINE AND METHOD FOR TREATING CANCER EMPLOYING TELOMERASE REVERSE TRANSCRIPTASE | ZANETTI M; | REGENTS OF THE UNIVERSITY OF CALIFORNIA; | Telomerase peptides which bind MHC are disclosed. The instant application also discloses vaccines containing said peptides and methods of using said peptides to enhance a CTL response against mammalian cancer cells | 2001 Feb 15 | 2001 Aug 23 |
| WO01070991 | VACCINE AGAINST MYCOBACTERIUM INFECTION BASED ON EPITOPES OF AG85 COMPLEX | KLEIN M; | GLAXO GROUP LIMITED; | CD8 T cell epitopes derived from Mycobacterium tuberculosis have the formula (I): X1PX2X3X4X5X6X7X8X9 wherein: X1 is W, X2 is T, X3 is L, X4 is I, X5 is G, X6 is L, X7 is A, X8 is V, L, I or M and X9 is absent; X1 is M, X2 is V, X3 and X4 are each G, X5 is Q, X6 and X7 are each S, X8 is F, Y or W and X9 is absent or is F, Y or W; or X1 is I or L, X2 is A, X3 is E or K, X4 is F, X5 is L, X6 is E, X7 is G or N, X8 is V, L, I, M, F, Y or W and X9 is absent | 2001 Mar 20 | 2001 Sep 27 |
| WO02004484 | HCV MOSAIC ANTIGEN COMPOSITION | CHAN H;THEOLIS R; | MedMira Inc.; | A highly immunoreactive mosaic antigen composition comprising a plurality of antigenic peptides derived from the core region of a polyprotein encoded by the hepatitis C virus (HCV) genome is provided for the purpose of detecting anti-HCV antibodies. The mosaic antigen composition essentially comprises a combination of six different antigenic peptides, ranging in length from 12 to 19 amino acid residues, which are individually immobilized through covalent linkage to a carrier component at their terminal end. The unique combination of HCV core peptides provided as a mosaic antigen composition having the three-dimensional configuration described herein results in higher specificity and sensitivity for detection of human antibodies specific to HCV in rapid HCV diagnostic applications. An in vitro diagnostic method for detecting anti-HCV antibodies in a test sample and a diagnostic test kit are also provided which utilize the mosaic antigen composition as an immunoreagent | 2001 Jul 6 | 2002 Jan 17 |
| WO02019986 | INDUCING CELLULAR IMMUNE RESPONSES TO HEPATITIS B VIRUS USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS | SIDNEY J;SOUTHWOOD S;VITIELLO M;LIVINGSTONE B;CELIS E;KUBO R;GREY H;CHESNUT R; | EPIMMUNE INC.;SETTE A; | This invention uses our knowledge of the mechanisms by which antigen is recognized by T cells to develop epitope-based vaccines directed towards HBV. More specifically, this application communicates our discovery of pharmaceutical compositions and methods of use in the prevention and treatment of HBV infection | 2000 Sep 8 | 2002 Mar 14 |
| WO02051237 | HELICOBACTER PROTEINS, NUCLEIC ACIDS AND USES THEREOF | TIAN JH;WALKER R;JACKSON W; | ANTEX BIOLOGICS I; | The invention discloses Helicobacter HP30 or HP56 polypeptide, polypeptides derived thereof (HP30-derived or HP56-derivedpolypeptides), nucleic acids encoding said polypeptides, antibodies that specifically bind the HP30, HP56, HP30-derived or HP56-derived polypeptides and T cells specific for HP30, HP56, HP30-derived or HP56-derived polypeptide. Also disclosed are prophylactic or therapeutic compositions, including immunogenic compositions, e.g. vaccines, comprising HP30, HP56, HP30-derived or HP56-derived polypeptides, nucleic acids encoding the same or antibodies thereto. The invention additionally discloses methods of inducing in animals an immune response to Helicobacter cells or antigens | 2001 Dec 7 | 2002 Jul 4 |
| WO02053182 | CHIMERIC T HELPER-B CELL PEPTIDE VACCINE FOR JAPANESE ENCEPHALITIS VIRUS | GORE M;KOLASKAR AS;DEWASTHALY SS;KALE U; | THE SECRETARY DEPARTMENT OF BIOTECHNOLOGY;NATIONAL INSTITUTE OF VIROLOGY;UNIVERSITY OF PUNE; | A vaccine composition for humans and animals against or Japanese encephalitis virus infection, comprising a chimeric synthetic peptide, said chimeric peptide selected from envelope glycoprotein, consisting of: amino acids Egp 149-SENHGHYSAQVGASQ-163 and Egp 427-GSIGGVFNSIGKAVHQVFG-445 of Japanese encephalitis virus envelope glycoprotein wherein chimeric peptide in an amount sufficient to induce protective immunity against Japanese encephalitis virus infection | 2002 Jan 4 | 2002 Jul 11 |
| WO02056905 | MOLECULAR ANTIGEN ARRAY | RENNER W;BACHMANN M;TISSOT A;MAURER P;LECHNER F;SEBBEL P;PIOSSEK C; | CYTOS BIOTECHNOLOGY AG; | The present invention is related to the fields of molecular biology, virology, immunology and medicine. The invention provides a composition comprising an ordered and repetitive antigen or antigenic determinant array. The invention also provides a process for producing an antigen or antigenic determinant in an ordered and repetitive array. The ordered and repetitive antigen or antigenic determinant is useful in the production of vaccines for the treatment of infectious diseases, the treatment of allergies and as a pharmaccine to prevent or cure cancer and to efficiently induce self-specific immune responses, in particular antibody responses | 2002 Jan 21 | 2002 Jul 25 |
| WO02069886 | MODIFIED PROTEINS, DESIGNER TOXINS, AND METHODS OF MAKING THEREOF | ROSENBLUM M;CHEUNG L; | RESEARCH DEVELOPMENT FOUNDATION; | The present invention concerns methods of reducing the antigenicity of a proteinaceous compound while maintaining the compounds biological activity, as well as proteinaceous compositions with biological activity but reduced antigenicity. These methods and compositions have significant benefits to a subject in need of such compounds and compositions. Also included are modified toxin compounds that are truncated and/or possess reduce antigenicity. Such designer toxins have therapeutic, diagnostic, and preventative benefits, particularly as immunotoxins. Methods of treating cancer using these immunotoxins are provided | 2002 Feb 12 | 2002 Sep 12 |
| WO02074920 | MOLECULAR VACCINE LINKING ANTIGEN WITH AN IMMUNOGENICITY-POTENTIATING POLYPEPTIDE DELIVERED AS REPLICATION DEFECTIVE ALPHAVIRUS REPLICONS FROM STABLE PACKAGING CELLS | WU TC;HUNG CF; | JOHNS HOPKINS UNIVERSITY; | Superior molecular vaccines comprise nucleic acids in the form of PCL-generated replication-defective alphavirus replicons, preferably Sindbis virus, that encode a fusion polypeptide that includes an antigenic peptide or polypeptide against which an immune response is desired. Fused to the antigenic peptide is at least a second polypeptide that is an immunogenicity-potentiating olypeptide acting by any of a number of mechanisms to promote immunogenicity of the antigen. Examples include intercellular spreading proteins, in particular a herpes virus protein VP22 or a homologue or functional derivative thereof. Other examples are proteins that stimulate MHC class I processing of the antigen, target the antigen to APCs promote development and growth of immature DCs or stimulate DC antigen presenting activity. The nucleic acid can encode any antigenic epitope of interest, preferably an epitope that is processed and presented by MHC class I proteins. Antigens of pathogenic organisms and cells such as tumor cells are preferred. Vaccines comprising HPV-16 E7 oncoprotein are exemplified. Also disclosed are methods of using the vaccines to induce heightened T cell mediated immunity, in particular by cytotoxic T lymphocytes, leading to protection from or treatment of a tumor | 2002 Mar 18 | 2002 Sep 26 |
| WO02076384 | THERAPEUTIC COMPOSITIONS THAT ALTER THE IMMUNE RESPONSE | SCHULTES B;NICODEMUS C; | ALTAREX CORP.; | The invention is therapeutic methods and compositions that alter the immunogenicity of the host | 2002 Mar 8 | 2002 Oct 3 |
| WO02082089 | ANTI-IDIOTYPIC ANTIBODY AND ITS USE IN DIAGNOSIS AND THERAPY OF HEPATITIS C VIRUS RELATED DISEASES | GRANT M; | IMMUNE NETWORK LTD.; | The present invention provides methods for the diagnosis, prognosis and treatment of HCV-related disease. The method takes advantage of a novel reactive mechanism of the murine monoclonal antibody (mAb) 1F7 against human antibodies specific for different proteins of the Hepatitis C virus (HCV) and Human immunodeficiency virus (HIV). 1F7 recognizes antibodies against HCV core protein in a majority of HCV-infected individuals and antibodies against HCV non-structural proteins 3 (NS3) and NS4 in some HCV-infected individuals. 1F7 also recognizes antibodies against the putative principle neutralizing determinant (hypervariable and conserved region 1 of the HCV E2 protein) of HCV. The antibody can be used in various methods to detect HCV related disease and formulated with physiologically acceptable carriers in various compositions to treat HCV infection | 2002 Apr 2 | 2002 Oct 17 |
| WO03059386 | PRION PROTEIN CARRIER-CONJUGATES | BACHMANN M;MAURER P;PELLICIOLI E;RENNER W; | CYTOS BIOTECHNOLOGY AG; | The present invention is related to the fields of molecular biology, virology, immunology and medicine. The invention provides a composition comprising an ordered and repetitive antigen or antigenic determinant array, and in particular a prion peptide or prion protein-VLP-array. More specifically, the invention provides a composition comprising a virus-like particle and at least one prion protein (PrP) or a dimer thereof, or a PrP peptide bound thereto. The invention also provides a process for producing the conjugates and the ordered and repetitive arrays, respectively. The compositions of the invention are useful in the production of vaccines for the treatment of prion diseases and as a pharmaccine to prevent or cure prion diseases and to efficiently induce immune responses, in particular antibody responses. Furthermore, the compositions of the invention are particularly useful to efficiently induce self-specific immune responses within the indicated context | 2003 Jan 17 | 2003 Jul 24 |
| WO03106478 | ANTIBODIES THAT BIND alphaE INTEGRIN | LU C; | MILLENNIUM PHARMACEUTICALS I; | Antibodies and antigen-binding fragments of antibodies that bind alpha E integrin are disclosed. Some of the antibodies and antigen-binding fragments bind an activation induced epitope on integrin alpha E chain. In some embodiments, the antibodies are human. Nucleic acids and vectors encoding the antibodies or portions thereof, recombinant cells that contain the nucleic acids, and compositions comprising the antibodies or antigen-binding fragments are also disclosed. The invention also provides therapeutic and diagnostic methods that employ the antibodies and antigen-binding fragments | 2003 Jun 10 | 2003 Dec 24 |
| WO04005316 | PREVENTION AND TREATMENT OF HCV INFECTION EMPLOYING ANTIBODIES DIRECTED AGAINST CONFORMATIONAL AND LINEAR EPITOPES | FOUNG S;KECK ZY; | BOARD OF TRUSTEES OF LELAND STANFORD JR.UNIVERSITY; | Conformational epitopes of the envelope proteins E1 and E2 of the Hepatitis C virus (HCV) have been identified and characterized using a panel of monoclonal antibodies derived from patients infected with HCV. These conserved conformational and linear epitopes of the HCV protein E1 or E2 have been determined to be important in the immune response of humans to HCV and may be particularly important in neutralizing the virus. Based on the identification of these conformational epitopes, vaccines containing peptides and mimotopes with these conformational epitopes intact may be prepared and administered to patients to prevent and/or treat HCV infection. The identification of four distinct groups of monoclonal antibodies with each directed to a particular epitope of E1 or E2 may be used to stratify patients based on their response to HCV and may be used to determine a proper treatment regimen | 2003 Jun 27 | 2004 Jan 15 |
| WO04006837 | MESOTHELIN VACCINES AND MODEL SYSTEMS | JAFFEE E;WU TC;HUNG CF;HRUBAN R; | THE JOHNS HOPKINS UNIVERSITY; | Mesothelin can be used as an immunotherapeutic target. It induces a cytolytic T cell response. Portions of mesothelin which induce such responses are identified. Vaccines can be either polynucleotide- or polypeptide-based. Carriers for raising a cytolytic T cell response include bacteria and viruses. A mouse model for testing vaccines and other anti-tumor therapeutics and prophylactics comprises a strongly mesothelin-expressing, transformed peritoneal cell line | 2003 Jul 14 | 2004 Jan 22 |
| WO04007556 | EXPRESSION OF HYDROPHOBIC PROTEINS | WEBB E;SCHOOFS P; | CSL LIMITED;THE COUNCIL OF THE QUEENSLAND INSTITUTE OF MEDICAL RESEARCH; | Methods are disclosed for the design of non-native (i.e. heterologous) polypeptides comprising a proportion of hydrophobic amino acids which have an increased probability of being efficiently expressed in an expression system such as a bacterial host (e.g. E. coli). The methods involve identifying one or more hydrophobic peptide sequences within a polypeptide of interest, and arranging or re-locating at least one of the hydrophobic peptide sequences within said polypeptide so as to generate a candidate polypeptide with reduced amplitude in hydrophobicity and/or length of any hydrophobic region(s). Such methods are particularly useful for designing polyepitope polypeptides, and specific examples of such are described for Epstein-Barr virus (EBV), hepatitis C virus (HCV) and human immunodeficiency virus (HIV) | 2003 Jul 14 | 2004 Jan 22 |
| WO04014957 | NOVEL IMMUNOGENIC LIPOPEPTIDES COMPRISING T-HELPER AND CYTOTOXIC T LYMPHOCYTE (CTL) EPITOPES | JACKSON D;ZENG W; | THE COUNCIL OF THE QUEENSLAND INSTITUTE OF MEDICAL RESEARCH; | The present invention provides synthetic immunogenic lipopeptide molecules comprising co-linear T-helper and CTL epitopes, and methods for their production and use in the generation of primary and secondary immune responses, and for the vaccination of animal subjects against particular CTL epitopes. More particularly, the present invention provides highly soluble lipopeptides wherein the lipid moiety is attached to the terminal side-chain group of an internal lysine or lysine analog, preferably to the terminal side-chain group of an internal diamino acid residue. Preferably the internal lysine or lysine analog is positioned between the T-helper epitope and the CTL epitope | 2003 Aug 12 | 2004 Feb 19 |
| WO04016282 | VACCINE COMPOSITIONS CONTAINING AMYLOID BETA1-6 ANTIGEN ARRAYS | BACHMANN M;TISSOT A;ORTMANN R;L 復ND R;STAUFENBIEL M;FREY P; | CYTOS BIOTECHNOLOGY AG;NOVARTIS PHARMA AG; | The present invention is related to the fields of molecular biology, virology, immunology and medicine. The invention provides a composition comprising an ordered and repetitive antigen or antigenic determinant array, and in particular an A beta 1-6 peptide-VLP-composition. More specifically, the invention provides a composition comprising a virus-like particle and at least one A beta 1-6 peptide bound thereto. The invention also provides a process for producing the conjugates and the ordered and repetitive arrays, respectively. The compositions of the invention are useful in the production of vaccines for the treatment of Alzheimer's disease and as a pharmaccine to prevent or cure Alzheimer's disease and to efficiently induce immune responses, in particular antibody responses. Furthermore, the compositions of the invention are particularly useful to efficiently induce self-specific immune responses within the indicated context | 2003 Jul 18 | 2004 Feb 26 |
| WO04016283 | MULTIMERIC COMPLEXES OF ANTIGENS AND ADJUVANTS | ANDREOLETTI P;DUMON L;HILL F;JULIEN M;MARCHAND JB;RISSE E; | AVIDIS SA; | The present invention provides a product comprising: a first component which is a scaffold; a second component which is an adjuvant, preferably a polypeptide which is a ligand for CD21 or a cell surface molecule on B cells or T cells or follicular dendritic or other antigen presenting cells; and a third component which is an antigen | 2003 Aug 12 | 2004 Feb 26 |
| WO04018684 | T-CELL EPITOPES IN STAPHYLOCOCCAL ENTEROTOXIN B | CARR F;BAKER M;CARTER G; | MERCK PATENT GMBH; | The present invention relates to the field of immunology. The invention identifies determinants on staphylococcal enterotoxin B (SEB) able to evoke an immune response. In particular the invention is concerned with the identification of epitopes for T-cells in SEB. The invention relates furthermore to T-cell epitope peptides derived from SEB by means of which it is possible to create modified SEB variants with reduced immunogenicity | 2003 Aug 18 | 2004 Mar 4 |
| WO04021871 | HCV ASSAY | ARCANGEL P;CHIEN D; | CHIRON CORPORATION; | An HCV antigen/antibody/antigen assay is provided. The assay employs an isolated first antigen from a region of the HCV polyprotein, and an HCV multiple epitope fusion antigen that includes an epitope from the same region of the polyprotein as the first antigen. Both the first antigen and the multiple epitope fusion antigen bind antibodies present in an HCV-infected sample | 2003 Sep 8 | 2004 Mar 18 |
| WO04024182 | METHOD FOR ISOLATING HEPATITIS C VIRUS PEPTIDES | BUSCHLE M;HABEL A;KLADE C;MATTNER F;OTAVA O;VYTVYTSKA O;ZAUNER W;ZINKE S;KIRLAPPOS H; | INTERCELL AG; | Described is a method for isolating Hepatitis C Virus peptides (HPs) which have a binding capacity to a MHC/HLA molecule or a complex comprising said HCV-peptide and said MHC/HLA molecule characterized by the following steps: - providing a pool of HCV-peptide, said pool containing HCV-peptides which bind to said MHC/HLA molecule and HCV-peptides which do not bind to said MHC/HLA molecule, -contacting said MHC/HLA molecule with said pool of HCV-peptides whereby a HCV-peptide which has a binding capacity to said MHC/HLA molecule binds to said MHC/HLA molecule and a complex comprising said HCV-peptide and said MHC/HLA molecule is formed, -detecting and optionally separating said complex from the HCV-peptide which do not bind to said MHC/HLA molecule and optionally isolating and characterising the HCV-peptide from said complex | 2003 Aug 27 | 2004 Mar 25 |
| WO04027049 | METHODS AND COMPOSITIONS TO GENERATE AND CONTROL THE EFFECTOR PROFILE OF T CELLS BY SIMULTANEOUS LOADING AND ACTIVATION OF SELECTED SUBSETS OF ANTIGEN PRESENTING CELLS | BOT A;WANG L;SMITH D;PHILLIPS B; | ASTRAL I; | Abstract The present invention is directed to novel compositions that cause effective redirection of class I-immunity to Te 1 effectors, that take advantage of the unexpected loading of MHC I by peptide within IgG backbone combined with appropriate instruction of antigen presenting cells. Such compositions are able to transform a seemingly ineffective therapeutics into a highly effective one, associated with generation of class I-restricted cytolytic cells and IFN-y, IL-2 producing T cells, further associated with protection against a highly virulent microbe or recovery from malignant tumoral process | 2003 Sep 18 | 2004 Apr 1 |
| WO04031211 | HLA BINDING PEPTIDES AND THEIR USES | SIDNEY J;SOUTHWOOD S;SETTE A; | EPIMMUNE INC.; | Provided herein are peptides in certian pathogens and/or human or murine proteins that are identified as capable of binding one or more MHC molecules and inducing an immume response in a system. Also provided are compositions that include one or more of the peptides and methods for inducing an immune reponse in a system by administering the compositions to the system | 2003 Oct 3 | 2004 Apr 15 |
| WO04031217 | VACCINES OF ENHANCED IMMUNOGENICITY, AND METHODS FOR PREPARING SUCH VACCINES | LAUVAU G;FIRAT H;SAVEANU L;LEMONNIER F;FRUCI D; | INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);VAN ENDERT P; | The invention relates to an immunogenic or vaccine composition comprising a peptide, a polypeptide or a vector that expresses a peptide or polypeptide, wherein the peptide or polypeptide comprises one or several epitope(s), that are extended with one to three or four aminoacids at the N-terminus of the epitope(s). The invention further relates to the preparation of this composition | 2003 Oct 7 | 2004 Apr 15 |
| WO04041842 | EPITOPES OF HEPATITIS C VIRUS | LAUER G;OUCHI K;WALKER B; | THE GENERAL HOSPITAL CORPORATION; | The invention provides compositions containing HCV epitopes, which are recognized by cytotoxic T lymphocytes. Such polypeptides are used in prophylactic vaccines, immunotherapies, and assays to monitor the progress or success of immune interventions. The compositions are optimized to elicit an immune response in a genetically-diverse population of individuals | 2003 May 16 | 2004 May 21 |
| WO04056312 | IMMUNOGLOBULIN VARIANTS AND USES THEREOF | ADAMS CW;CHAN AC;CROWLEY CW;LOWMAN HB;NAKAMURA GR;PRESTA LG; | GENENTECH I; | The invention provides humanized and chimeric anti-CD20 antibodies for treatment of CD20 positive malignancies and autoimmune diseases | 2003 Dec 16 | 2004 Jul 8 |
| WO04058044 | DIAGNOSTIC METHOD FOR DISEASES BY SCREENING FOR HEPCIDIN IN HUMAN OR ANIMAL TISSUES, BLOOD OR BODY FLUIDS AND THERAPEUTIC USES THEREFOR | GEACINTOV C;JANETZKO A;STREMMEL W;KULAKSIZ H; | DRG INTERNATIONAL I; | The present invention concerns methods and kits for diagnosing a disease condition characterized by non-physiological levels of hepcidin protein, including prohepcidin and fragments thereof, comprising obtaining a tissue or fluid sample from a subject; contacting the sample with an antibody or fragment thereof that specifically binds to a polypeptide corresponding to the mid-portion or C terminus of a hepcidin protein, and quantifying the hepcidin level using an assay based on binding of the antibody and the polypeptide; wherein the non-physiological level of hepcidin is indicative of the disease condition. The present invention also concerns diagnostic methods and kits for applications in genetic technological approaches, such as for overexpressing or downregulating hepcidin. The present invention further concerns therapeutic treatment of certain diseases by treatment of subjects with hepcidin and agonists or antagonists of hepcidin | 2003 Nov 19 | 2004 Jul 15 |
| WO04074479 | METHODS OF CONSTRUCTING BIODIVERSE GENE FRAGMENT LIBRARIES AND BIOLOGICAL MODULATORS ISOLATED THEREFROM | WATT P;THOMAS W;HOPKINS R; | PHYLOGICA LIMITED; | Methods for producing nucleic acid fragment libraries that express highly diverse peptide domains, wherein the nucleic acid fragments are derived form microorganisms or eukaryotes with compact genomes. Also peptides derived form the libraries wherein the peptides are selected on the basis of their abilities to bind selected target proteins, including c-jun and antibodies raised against dust mite allergens | 2004 Feb 20 | 2004 Sep 2 |
| WO84003564 | METHOD OF DETERMINING ANTIGENICALLY ACTIVE AMINO ACID SEQUENCES | GEYSEN H; | COMMONWEALTH SERUM LABORATORIES COMMISSION;GEYSEN H; | A method of detecting or determining a sequence of amino acids which is antigenically active within a known amino acid sequence of a protein or portion thereof comprises the steps of: 1. synthesising a plurality of peptides, each of said peptides comprising a sequence of a plurality of amino acids which corresponds to a sequence within the known amino acid sequence, and the said peptides having overlapping amino acid sequences; 2. contacting each of said peptides with antibody against the protein or portion of interest; and 3. detecting or determining the presence or absence of an antigen-antibody reaction between each of said peptides and said antibody to indicate whether or not said peptide has antigenic activity | 1984 Mar 8 | 1984 Sep 13 |
| WO92016234 | METHOD OF MODULATING MAMMALIAN T-CELL RESPONSE | WILLIAMS W;RUBIN D;WEINER D;GREENE M; | THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA; | Methods of modulating mammalian T-cell response restricted by an MHC and methods of treating an MHC-linked disease in a mammal suspected of requiring such modulation or treatment, are provided by the invention. The methods comprise treating the mammal or contacting the T-cells respectively with an effective amount of a peptide, which peptide has an amino acid sequence substantially corresponding to at least a portion of the antigen recognition site of said MHC, or a peptide mimetic wherein said peptide or peptide mimetic is capable of binding with a T-cell antigen receptor which unbound T-cell antigen receptor is capable of recognizing said MHC bound to an antigen | 1992 Mar 20 | 1992 Oct 1 |
| WO94025486 | IMPROVED HCV DIAGNOSTIC AGENTS | CHO J;CHOI D;KIM C;SO H;YANG J;KIM I;KIM J; | LUCKY LIMITED;CHO J;CHOI D;KIM C;SO H;YANG J;KIM I;KIM J; | The present invention relates to the epitopes of hepatitis C virus (HCV) core protein and non-structural 3 protein (NS3), and the epitopes of envelope protein, epitopes of non-structural 4 protein, and the epitopes of HCV non-structural 5 protein and a recombinant protein comprising the same; processes for producing the recombinant proteins; an agent for diagnosing antibodies against hepatitis C virus in a putative serum sample, which comprises said recombinant proteins; and a process for diagnosing hepatitis C by using the agent | 1994 Apr 29 | 1994 Nov 10 |
| WO96040785 | MONOSPECIFIC ANTIBODIES AND METHODS USING THEM | CALAYCAY J;HUMES J;MUMFORD R;SINGER I;WEIDNER J; | CO. I;CALAYCAY J;HUMES J;MUMFORD R;SINGER I;WEIDNER J; | Monospecific antibodies are produced which are specific for the carboxyl-terminal region of human inducible nitric oxide synthase (hiNOS). These monospecific antibodies are used in an assay systems to detect hiNOS. Elevations of hiNOS occur in hepatitis and inflammatory bowel disease, as well as numerous inflammatory diseases. The monospecific antibodies and the assay systems are used to quantitate hiNOS as a readout of hiNOS activity and to evaluate potential hiNOS modulators | 1996 Jun 3 | 1996 Dec 19 |
| WO97040147 | ANTIGENICALLY REACTIVE REGIONS OF THE HEPATITIS A VIRUS POLYPROTEIN | FIELDS H;KHUDYAKOV YE; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbTSOTDOHAHSCfDCaPTTO; | The present provides immunogenic HAV peptides, antibodies and assays for detecting HAV. Vaccines against HAV are also provided | 1997 Apr 18 | 1997 Oct 30 |
| WO97040163 | NUCLEIC ACID VACCINATION FOR PARVOVIRAL INFECTIONS | SCHORR J;BAKER H;SMITH B; | COLPAN M; | The general field of the invention is a method for nucleic acid vaccination of animals to protect them from parvoviral infections. This invention is more particulary related to the preparation and use of parvoviral DNA and its administration to dogs, cats and mink so as to induce an immune response that can protect these animals from disease caused by virulante parvovirus. Nucleic acid immunogens are designed to include the antigenic portions of the parvoviral genome which are incorporated into bacterial plasmids. These plasmids produce the desired parvoviral gene product when introduced into host cells by transfection. Host cells transfected with the parvoviral immunogen expressing plasmids produce a stream of antigenic proteins to which the host immune system will mount a protective immune response | 1997 Apr 18 | 1997 Oct 30 |
| WO99000424 | ANTIBODIES AND OTHER BINDING MOLECULES SPECIFIC FOR HEPATITIS B VIRAL ANTIGENS | PAULIJ W;VAN KESSEL-KOENS MJ; | AKZO NOBEL NV; | The present invention relates to antibodies and other binding molecules specific for hepatitis B viral antigens (HBV), peptides comprising epitopes recognised by such molecules, and cell lines capable of producing antibodies. The invention is further concerned with the use of such molecules in diagnosis of hepatitis B virus (HBV). The invention further relates to a method for the diagnosis of hepatitis B, the method comprising contacting the sample suspected to contain hepatitis B particles or antigens with the specific binding molecule according to the invention. More preferred, the invention relates to a method for the diagnosis of hepatitis B, the method comprising contacting the sample suspected to contain hepatitis B particles or antigens with at least one specific binding molecule directed to the S-region of HBV and at least one specific binding molecule according to the present invention. The invention further relates to an assay kit for the detection of a hepatitis B particle or antigen, the kit comprising a specific binding molecule according to the invention and means for detecting whether the specific binding molecule is bound to a hepatitis B particle or antigen | 1998 Jun 22 | 1999 Jan 7 |
| WO99003871 | HEXADECASACCHARIDE.ndash.PROTEIN CONJUGATE VACCINE FOR SHIGELLA DYSENTERIAE TYPE 1 | POZSGAY V;ROBBINS J;SCHNEERSON R; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA arbTSDOHAHS; | The present invention pertains to isolated natural, modified natural or synthetic oligo- or polysaccharides which have [3)-\Aalpha;-L-Rhai(p)-(1\Ararr;2)-\Aalpha;-D-Gali(p)-(1\Ararr; 3)-\Aalpha;-D-Glci(p)NAc-(1\Ararr;3)-\Aalpha;-L-Rhai(p)-(1\Ararr;]n subunits and which are structurally related to and/or antigenically similar to an antigenic determinant of the O-specific polysaccharide of i(Shigella dysenteriae) type 1. The oligo- or polysaccharides may be conjugated to a carrier to form conjugates. These oligo- or polysaccharides and conjugates thereof are immunogenic and elicit serum antibodies that are bactericidal or bacteriostatic against i(Shigella dysenteriae), in particular i(Shigella dysenteriae) type 1, and are useful in the prevention and treatment of shigellosis. These oligo- or polysaccharides and conjugates thereof, and the antibodies which they elicit, are also useful for diagnosing shigellosis caused by i(Shigella dysentariae) type 1 | 1998 Jul 15 | 1999 Jan 28 |
| WO99060132 | MIMOTOPES OF HYPERVARIABLE REGION 1 OF THE E2 GLYCOPROTEIN OF HCV AND USES THEREOF | NICOSIA A;LAHM A;TRAMONTANO A;CORTESE R; | ISTITUTO DI RICERCHE DI BIOLOGIA MOLECOLARE; | Peptides which are mimotopes of the hypervariable region 1 (HVR1) of the putative envelope protein E2 of hepatitis C virus (HCV) are provided, useful in obtaining antibodies and raising an immune response cross-reactive against different strains of HCV | 1999 May 14 | 1999 Nov 25 |
| WO99061477 | MONOCLONAL ANTIBODY AND ASSAY FOR DETECTING PIIINP | BURCHARDT E;KROLL W;GEHRMANN M;SCHR?ER W; | BAYER AKTI; | The present invention relates to monoclonal antibodies binding to the N-terminal procollagen (III) propeptide (PIIINP) molecule which is a proteolytic fragment emanating from the specific cleavage of procollagen (III) by N-proteinase after exocytosis and to an assay using these antibodies | 1999 May 17 | 1999 Dec 2 |
| WO00002907 | TUMOR ANTIGEN PEPTIDE ORIGINATING IN SART.ndash.1 | NAKAO M; | ITOH K; | A tumor antigen peptide originating in SART-1 or its derivative being equivalent thereto in the functional properties; and remedies, preventives, etc. for tumor with the use of the tumor antigen peptide, etc | 1999 Jul 7 | 2000 Jan 20 |
| WO0005254 | NOVEL PEPTIDES FOR USE IN IMMUNOTHERAPY OF AUTOIMMUNE DISEASES | VERHEIJDEN G;BOOTS A; | AKZO NOBEL NV; | The invention relates to the use of novel peptides in a peptide induced tolerance therapy to prevent autoimmune disorders and in particular their use in treatment of chronic destruction of articular cartilage. The invention furthermore embraces pharmaceutical compositions comprising said peptides and a diagnostic method for the detection of autoreactive T cells in a test sample | 1999 Jul 16 | 2000 Feb 3 |
| WO00032770 | NOVEL TUMOR ANTIGEN PROTEIN ART.ndash.1 AND TUMOR ANTIGEN PEPTIDE THEREOF | GOMI S; | ITOH K; | A novel tumor antigen protein; its gene; a tumor antigen peptide originating in the tumor antigen protein; derivatives of these substances; and remedies, preventives or diagnostics for tumor with the use of these substances either i(in vivo) or i(in vitro) | 1999 Nov 30 | 2000 Jun 8 |
| WO01011044 | TUMOR ANTIGEN | ITOH KYOG; | ITOH K; | A tumor antigen peptide capable of inducing and/or activating HLA-A24 restraint and/or HLA-A2 restrain tumor-specific cytotoxic T cells; a polynucleotide encoding this peptide or its complementary strand; a recombinant vector containing this polynucleotide; a transformant containing this recombinant vector; a process for producing the peptide; an antibody against the peptide; a compound undergoing interactions with these substances; a method of screening the compound; medicinal compositions with the use of these substances; and a means of diagnosing by using the same | 2000 Aug 3 | 2001 Feb 15 |
| WO01087337 | HUMAN POLYPEPTIDES CAUSING OR LEADING TO THE KILLING OF CELLS INCLUDING LYMPHOID TUMOR CELLS | NAGY Z;BRUNNER C;TESAR M;THOMASSEN-WOLF E; | GPC BIOTECH AG;MORPHOSYS AG; | The present invention relates to polypeptide compositions which bind to cell surface epitopes and, in multivalent forms, cause or lead to the killing of cells including lymphoid tumor cells, and in the case of monovalent forms, cause immunosuppression or otherwise inhibit activation of lymphocytes. The invention further relates to nucleic acids encoding the polypeptides, methods for the production of the polypeptides, methods for killing cells, methods for immunosuppressing a patient, pharmaceutical, diagnostic and multivalent compositions and kits comprising the polypeptides and uses of the polypeptides | 2001 May 14 | 2001 Nov 22 |
| WO02095051 | MAGE-A3 PEPTIDES PRESENTED BY HLA CLASS II MOLECULES | ZHANG Y;CHAUX P;BOON-FALLEUR T;VAN DER BRUGGEN P; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention describes HLA class II binding peptides encoded by the MAGE-A3 tumor associated gene, as well as nucleic acids encoding such peptides and antibodies relating thereto. The peptides stimulate the activity and proliferation of CD4+ T lymphocytes. Methods and products also are provided for diagnosing and treating conditions characterized by expression of the MAGE-A3 gene | 2002 May 16 | 2002 Nov 28 |
| WO03012047 | ISOLATION OF MEMBRANE BOUND LIGAND-SPECIFIC COMPLEXES | JAKOBOVITS A;CHALLITA-EID P; | AGENSYS I; | A method to recover or 'deracinate' receptors from intact membranes in their native configuration without removing microenvironmental components associated with them is described. The membranes containing the receptors are first associated with ligand-coupled solid supports to achieve association of the membranes through a receptor/ligand complex which includes the microenvironmental to the solid support and then removing the membrane from the receptor and its microenvironment by shear forces. The thus isolated receptors and their microenvironments can then be analyzed for their role in cellular differentiation, apoptosis, transformation and the like | 2002 Jul 29 | 2003 Feb 13 |
| WO03015812 | NOVEL METHOD FOR DOWN-REGULATION OF AMYLOID | RASMUSSEN P;JENSEN M;NIELSEN K;KOEFOED P;DEGAN F; | PHARMEXA A; | Disclosed are novel methods for combatting diseases characterized by deposition of amyloid. The methods generally rely on immunization against amyloid precursor protein (APP) or beta amyloid (A bata). Immunization is preferably effected by administration of analogues of autologous APP or A beta, said analogues being capable of inducing antibody production against the autologous amyloidogenic polypeptides. Especially preferred as an immunogen is autologous A beta which has been modified by introduction of one single or a few foreign, immunodominant and promiscuous T-cell epitopes. Also disclosed are nucleic acid vaccination against APP or A beta and vaccination using live vaccines as well as methods and means useful for the vaccination. Such methods and means include methods for the preparation of analogues and pharmaceutical formulations, as well as nucleic acid fragments, vectors, transformed cells, polypeptides and pharmaceutical formulations | 2002 Aug 20 | 2003 Feb 27 |
| WO03017935 | HUMAN ANTIBODIES SPECIFIC FOR INTERLEUKIN 15 (IL-15) | VAN DE WINKEL J;VAN DIJK M;SCHUURMAN J;GERRITSEN A;BAADSGAARD O; | GENMAB I; | Isolated human monoclonal antibodies which specifically bind to IL-15 (e.g., human IL-15), and related antibody-based compositions and molecules, are disclosed. The human antibodies can be produced in a transfectoma or in a non-human transgenic animal, e.g., a transgenic mouse, capable of producing multiple isotypes of human monoclonal antibodies by undergoing V-D-J recombination and isotype switching. Also disclosed are pharmaceutical compositions comprising the human antibodies, non-human transgenic animals, and hybridomas which produce the human antibodies, and therapeutic and diagnostic methods for using the human antibodies | 2002 Aug 23 | 2003 Mar 6 |
| WO03024998 | T CELL EPITOPES OF THE CYN D 1 ALLERGEN FROM BERMUDA GRASS POLLEN | O'HEHIR R;ROLLAND J; | MONASH UNIVERSITY; | The present invention relates generally to molecules such as peptides, polypeptides and proteins which interact immunologically with T cell lymphocytes in subjects having Bermuda grass allergy and genetic sequences encoding same. These molecules are preferentially immunointeractive with T cells in subjects having a Bermuda grass pollen allergy. The molecules of the present invention are useful in the development of diagnostic, therapeutic and prophylactic agents for conditions characterised by an aberrant, inappropriate or otherwise unwanted immune response to Bermuda grass pollen or derivative or homologue thereof | 2002 Sep 18 | 2003 Mar 27 |
| WO03025000 | PEPTIDES CAPABLE OF MODULATING IMMUNE RESPONSE | UTKU NALA; | UTKU N; | Provided are peptides capable of inhibiting proliferation of peripheral blood mononuclear cells (PBMCs) derived from HLA class II alpha 2 chain. Furthermore, peptides capable of inhibiting proliferation of peripheral blood mononuclear cells (PBMCs) derived from T-cell immune response cDNA 7 (TIRC7) costimulatory molecule are described. Compositions comprising such peptides and their use for the treatment of immune diseases are provided | 2002 Sep 17 | 2003 Mar 27 |
| WO03025009 | RECOMBINANT ALLERGEN WITH REDUCED IgE BINDING BUT UNDIMINISHED T-CELL ANTIGENICITY | DEWEERD N;SINGH M;BHALLA P;SWOBODA I; | THE UNIVERSITY OF MELBOURNE; | The present invention relates generally to reagents useful in the immunotherapeutic or immunoprophylactic treatment of allergic diseases. More particularly, the present invention provides modified allergens exhibiting reduced IgE interactivity including reduced IgE production-stimulatory activity, while retaining T-cell antigenicity, which are useful in the immunomodulation of type I allergic disease conditions. The present invention further contemplates a method of immunomodulation of allergic diseases such as type I allergic disease conditions by the administration of modified allergens exhibiting reduced IgE interactivity while retaining T-cell antigenicity | 2002 Sep 13 | 2003 Mar 27 |
| WO03035682 | MOLECULES BINDING TO GLU-PRO MOTIFS, THERAPEUTICAL COMPOSITIONS CONTAINING THEM AND THEIR APPLICATIONS | TRIEBEL F; | INSTITUT GUSTAVE ROUS;UNIVERSITY PARIS-SUD; | The present invention relates to molecules binding to specific targets comprising Glu-Pro (EP) repeated motifs, namely to molecules binding to a target comprising an EP motif having the following sequence [X- (EP)n-Y-(EP)m-Z]p wherein X, Y and Z, identical or different comprise a sequence of 0 to 10 aminoacids, identical or different, n, m are integers comprised between 0 to 20, preferably between 3 to 10 at least one from n or m being different from 0 and p is an integer comprised between 1 and 10. The invention relates also to pharmaceutical compositions containing them, to antibodies directed against them and to methods useful for screening drugs by using them | 2002 Sep 17 | 2003 May 1 |
| WO89006974 | T-CELL EPITOPE AS CARRIERS MOLECULE FOR CONJUGATE VACCINES | BIXLER GARV;PILLAI SUBR;INSEL RICH; | PRAXIS BIOLOGICS I; | The present invention relates to novel T-cell epitopes of bacterial products. The epitopes of the invention may be employed in the preparation of conjugates between the epitopes and medically useful antigens, haptens, or antigenic determinants. These conjugates are capable of eliciting antibody responses similar to conjugates of antigens covalently coupled to carrier proteins, and in a vaccine composition, provide a safe and more economic conjugate vaccines | 1989 Jan 31 | 1989 Aug 10 |
| WO92001713 | PEPTIDES AND ANALOGUES AND MIXTURES THEREOF FOR DETECTING ANTIBODIES TO HTLV-I AND HTLV-II VIRUSES | LACROIX M;ZREIN M; | IAF BIOCHEM INTERNATIONAL INC.; | This invention relates to novel linear peptides and mixtures and chemical combinations thereof useful for detecting and quantifying HTLV-I and HTLV-II infections. These peptides are also useful in vaccines against HTLV-I and HTLV-II viral infections | 1991 Jul 10 | 1992 Feb 6 |
| WO93011237 | CDR GRAFTED HUMANISED CHIMERIC T-CELL ANTIBODIES | WALDMANN H;WALSH L;CROWE J;LEWIS A; | THE WELLCOME FOUNDATION LIMITED;WALDMANN H;WALSH L;CROWE J;LEWIS A; | A humanised antibody is provided in which the amino acid sequence of the CDRs is derived from the sequence of the CDRs of a monoclonal antibody having the specificity of binding to resting and activated T-cells, inhibiting T-cell proliferation and lysing T-cells from mice transgenic for human CD2 and in which sufficient of the amino acid sequence of each CDR has been retained to provide the same specificity for the humanised antibody | 1992 Dec 4 | 1993 Jun 10 |
| WO95007073 | CHEMICALLY-DEFINED NON-POLYMERIC VALENCY PLATFORM MOLECULES AND CONJUGATES THEREOF | COUTTS S;JONES D;LIVINGSTON D;YU L; | LA JOLLA PHARMACEUTICAL COMPANY;COUTTS S;JONES D;LIVINGSTON D;YU L; | Chemically-defined, non polymeric valency platform molecules and conjugates comprising chemically-defined valency platform molecules and biological or synthetic molecules including polynucleotide duplexes of at least 20 base pairs that have significant binding activity for human lupus anti-dsDNA autoantibodies | 1994 Sep 8 | 1995 Mar 16 |
| WO98035698 | REMEDIES FOR LYMPHOCYTIC TUMORS | KOISHIHARA Y;YOSHIMURA Y; | CHUGAI SEIYAKU KABUSHIKI KAIS; | Remedies for lymphocytic tumors excluding myeloma which contain as the active ingredient an antibody binding specifically to a protein having the amino acid sequence represented by SEQ ID NO:1 and having a cytotoxic activity | 1998 Feb 12 | 1998 Aug 20 |
| WO99014326 | MAGE.ndash.3 PEPTIDES PRESENTED BY HLA CLASS II MOLECULES | THIELEMANS K;HEIRMAN C;CORTHALS J;CHAUX P;STROOBANT V;BOON-FALLEUR T;VAN DER BRUGGEN P;LUITEN R; | VRIJE UNIVERSITEIT BRUSSEL; | The invention describes HLA class II binding peptides encoded by the MAGE-3 tumor associated gene, as well as nucleic acids encoding such peptides and antibodies relating thereto. The peptides stimulate the activity and proliferation of CD4+T lymphocytes. Methods and products are also provided for diagnosing and treating conditions characterized by expression of the MAGE-3 gene | 1998 Sep 4 | 1999 Mar 25 |
| WO99029715 | TUMOR ANTIGEN PEPTIDE DERIVATIVES | SHICHIJO S;IMAI Y; | ITOH K; | Tumor antigen peptide derivatives containing the whole amino acid sequence derived from the amino acid sequence Glu Tyr Arg Gly Phe Thr Gln Asp Phe (SEQ ID NO:3) by altering one to several amino acid residues or a part thereof and capable of binding to HLA-A24 antigen and thus being recognized by cytotoxic T cells; the use of these tumor antigen peptide derivatives in treating, preventing and diagnosing tumors; and remedies or preventives for tumors containing these peptide derivatives as the active ingredient | 1998 Dec 2 | 1999 Jun 17 |
| WO02098370 | METHODS OF ADMINISTERING/DOSING CD2 ANTAGONISTS FOR THE PREVENTION AND TREATMENT OF AUTOIMMUNE DISORDERS OR INFLAMMATORY DISORDERS | DINGIVAN C; | MEDIMMUNE I; | The present invention provides compositions for the prevention or treatement of an autoimmune disorder or an inflammatory disorder in a subject comprising one or more CD2 antagonists. In particular, the invention provide methods for preventing or treating anautoimmune disorder or an inflammatory disorder in a subject comprising administering one or more CD2 binding molecules to said subject. The present invention provides doses of CD2 binding molecules and methods of administration that result in improved efficacy, while avoiding or reducing the adverse or unwanted side effects associated with the administration of an agent that induces the depletion of peripheral blood lymphocytes | 2002 Mar 4 | 2002 Dec 12 |
| WO00063385 | NUCLEIC ACID IMMUNIZATION | CHEN D;FULLER J; | POWDERJECT VACCINES I; | Recombinant nucleic acid molecules are described. The molecules have a first sequence encoding a peptide that mimics a target antigen. Reagents, including vectors and compositions containing these molecules are also described. Methods for constructing these reagents, and methods for using these reagents to elicit an immune response are also described | 2000 Apr 21 | 2000 Oct 26 |
| WO01077156 | NEUTRALIZING IMMUNOGENIC HEV POLYPEPTIDES | FIELDS H;KHUDYAKOV Y;MENG J; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA arbTSOTDOHAHS; | The present invention provides immunogenic Hepatitis E Virus polypeptides and methods of use. The polypeptides include at least one neutralizing antigenic epitope and preferably contain at least about fifty amino acids residues between amino acid residues 452 and 617 from the C-terminal of the HEV pORF2 protein. The polypeptides are useful, alone or in combination with other polypeptides of the present invention, as a reagent for studying the pathogenesis of HEV and monitoring treatment efficacy in subjects undergoing treatment for HEV. Further, the polypeptides can be used as a vaccine to treat or prevent HEV | 2001 Apr 3 | 2001 Oct 18 |
| WO01085208 | MOLECULAR ANTIGEN ARRAY | SEBBEL PETE;DUNANT NICO;BACHMANN MART;TISSOT ALAI;LECHENER FRAN; | CYTOS BIOTECHNOLOGY AG;SEBBEL P;DUNANT N;BACHMANN M;TISSOT A;LECHENER F; | The invention provides compositions and processes for the production of ordered and repetitive antigen or antigenic determinant arrays. The compositions of the invention are useful for the production of vaccines for the prevention of infectious diseases, the treatment of allergies and the treatment of cancers. Various embodiments of the invention provide for a core particle that is coated with any desired antigen in a highly ordered and repetitive fashion as the result of specific interactions | 2001 May 2 | 2001 Nov 15 |
| WO01093804 | HEPATITIS C VIRUS CONJUGATES | CONLEY A;MCKENNA P;PRZYSIECKI C;KELLER P; | CO. I; | The present invention features HCV conjugates able to induce an immune response recognizing different strains and variants of HCV. The conjugates contain a polypeptide or protein complex carrier and one or more HCV mimotopes. Preferred HCV mimotopes provide antigens able to generate antibodies recognizing the hypervariable region of the HCV E2 protein | 2001 May 29 | 2001 Dec 13 |
| WO01096870 | IMMUNOASSAYS FOR ANTI-HCV ANTIBODIES | CHIEN D;ARCANGEL P;TANDESKE L;GEORGE-NASCIEMENTO C;COIT D;MEDINA-SELBY A; | CHIRON CORPORATION; | HCV immunoassays comprising an NS3/4a conformational epitope and a multiple epitope fusion antigen are provided, as well as immunoassay solid supports for use with the immunoassays | 2001 Jun 14 | 2001 Dec 20 |
| WO01096875 | HCV ANTIGEN/ANTIBODY COMBINATION ASSAY | CHIEN D;ARCANGEL P;TANDESKE L;GEORGE-NASCIEMENTO C;COIT D;MEDINA-SELBY A; | CHIRON CORPORATION; | An HCV core antigen and NS3/4a antibody combination assay that can detect both HCV antigens and antibodies present in a sample using a single solid matrix, is provided, as well as immunoassay solid supports for use in the assay | 2001 Jun 14 | 2001 Dec 20 |
| WO02012286 | STRESS PROTEINS AND PEPTIDES AND METHODS OF USE THEREOF | ALBANI S;PRAKKEN B; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA_SAN DIEGO; | Provided are HLA pan DR peptide and methods of using such peptides to modulate, block, or inhibit immune responses in treatment of immune-mediated diseases and conditions, such as inflammatory and autoimmune diseases, cancer, and microbial infections. The peptides and methods are useful diagnostically to screen peptide or peptide analogs that can inhibit the pathogenic immune response or upregulate an immune response against aberrant or invading cells, to monitor efficacy or therapeutic use and to identify other agents that may be effective to inhibit or modulate the immune response | 2001 Aug 8 | 2002 Feb 14 |
| WO02014478 | IMMUNOGENIC HBc CHIMER PARTICLES HAVING ENHANCED STABILITY | BIRKETT A; | APOVIA I; | A chimeric, carboxy-terminal truncated hepatitis B virus nucleocapsid protein (HBc) is disclosed that is engineered for both enhanced stability of self-assembled particles and the display of an immunogenic epitope. The display of the immunogenic epitope is displayed in the immunogenic loop of HBc, whereas the enhanced stability of self-assembled particles is obtained by the presence of at least one heterologous cysteine residue near the carboxy-terminus of the chimer molecule. Methods of making and using the chimers are also disclosed | 2001 Aug 16 | 2002 Feb 21 |
| WO02022803 | PEPTIDE EPITOPES RECOGNIZED BY ANTIGEN SPECIFIC CD4+ T LYMPHOCYTES | CHICZ R;TOMLINSON A; | ZYCOS INC.; | The invention provides methods for identifying and validating epitopes that are bound to class II MHC molecules and activate CD4+ T cells involved in the pathogenesis of or protection from diseases, e.g., cancer. The invention includes peptide epitopes (including altered peptide ligands) derived from the CEA polypeptide by such methods, and methods of therapeutic use of these epitopes against diseases such as cancers | 2001 Sep 12 | 2002 Mar 21 |
| WO02024224 | VACCINATION METHOD | HILL A;McSHANE H;GILBERT S;REECE W;SCHNEIDER J; | OXXON PHARMACCINES LIMITED; | There is provided a method of inducing a CD4+ T-cell response against a target antigen, by administering a composition a source of one or more CD4+ epitopes is a non-replicating or replication impaired recombinant poxvirus vector | 2001 Sep 13 | 2002 Mar 28 |
| WO02024887 | LIGAND/RECEPTOR SPECIFICITY EXCHANGERS THAT REDIRECT ANTIBODIES TO RECEPTORS ON A PATHOGEN | SALLBERG M;FLOCK JI; | TRIPEP AB; | The present invention generally relates to compositions and methods for preventing and treating human diseases including, but not limited to, pathogens such as bacteria, yeast, parasites, fungus, viruses, and cancer. More specifically, embodiments described herein concern the manufacture and use of ligand/receptor specificity exchangers, which redirect existing antibodies in a subject to receptors present on pathogens | 2001 Sep 19 | 2002 Mar 28 |
| WO02026251 | ATTENUATED SALMONELLA MICROORGANISMS COMPRISING A MUTATION IN THE SIFA GENE | BRENNAN F;DOUGAN G; | MICROSCIENCE LIMITED; | An attenuated Salmonella microorganism comprises a mutation in the sifA gene and a heterologous antigen. The microorganism may be administered as a therapeutic, to deliver the antigen to a cell cytosol to thereby induce a MHC Class-I-restricted T cell response | 2001 Oct 1 | 2002 Apr 4 |
| WO02034770 | IDENTIFICATION OF HLA-DR RESTRICTED HCV EPITOPES | GODKIN A;THOMAS H; | IMPERIAL COLLEGE INNOVATIONS LIMITED; | Use of a polypeptide having one or more copies of one or more epitopes selected from epitopes present in the regions between amino acids 31-45, 141-155, 1207-1221, 2268-2284 and/or 2941-2955 of a native HCV polypeptide, in the manufacture of a medicament for the treatment of a patient with or at risk of hepatitis C infection, wherein the patient is of HLA type DR11 or DR12 and wherein the polypeptide (1) does not comprise a sequence of more than 30 contiguous amino acids from a native HCV polypeptide and/or (2) the polypeptide is of about 8 to about 100 amino acids in length. A method of determining the relative prospects of a particular outcome for a subject of exposure to HCV and/or HCV infection, comprising the step of determining whether the subject has an immune response to one or more epitopes present in a region between amino acids 31-45, 141-155, 1207-1221, 2268-2284 and/or 2941-2955 of a native HCV polypeptide | 2001 Oct 18 | 2002 May 2 |
| WO02037115 | DETECTION OF INFECTIOUS AGENTS USING ANTIGEN MIMICS | FELICI F;GARGANO N;MINENKOVA O;MONACI P; | KENTON SRL; | A method for making a diagnosis of an antigen, comprising identifying the binding specificity of the anti-antigen antibody molecules in the serum by the Antibody Detection by Antigen Mimics (ADAM) methodology, comprising screening phage libraries using sera from antigen-infected patients and non-infected individuals, identifying peptides binding antibodies (ligands) specifically associated with said antigen. Improvements of the method are given by in vitro maturation strategies; linking the ligands to a common core, such as MAP. In particular the method applies to HCV | 2000 Nov 3 | 2002 May 10 |
| WO02045743 | HCV VACCINES | LI C;PICCOLELLA E; | ALLAIN JP; | HCV vaccines are described which are capable of raising antibodies and/or helper T lymphocytes and/or cytotoxic T lymphocytes which are cross-reactive to the hypervariable 1 (HVR 1) region of the envelope protein E2 of different HCV strains. A preferred therapeutic vaccine for treatment of chronic HCV infection comprises a plurality of different groups of peptides, each peptide comprising a different known HVR 1 C-terminal sequence or a different consensus of known HVR 1 C-terminal sequences. The different groups of peptides are sequentially administered (preferably at intervals of 15-21 days) to raise antibodies, helper t lymphocytes, and cytotoxic T lymphocytes which are cross-reactive to the HVR 1 region(s) of the chronically infecting HCV strain(s). methods of selecting peptides for use in such vaccines are also described | 2001 Dec 7 | 2002 Jun 13 |
| WO01070764 | EPITOPES | KLEIN M; | GLAXO GROUP LIMITED; | CD8 T cell epitopes derived from Mycobacterium tuberculosis have the formula (I): X1PX2X3X4X5X6X7X8X9 wherein: X1 is E, X2 is Y, X3 is L, X4 is D, X5 is P, X6 is A, X7 is T, X8 is V, L, I or M and X9 is absent; X1 is L, X2 is G, X3 is T, X4 is A, X5 and X6 are each V, X7 is P, X8 is V, L, I or M and X9 is absent, X1 is T, X2 is A, X3 is N, X4 is Q, X5 is A, X6 is I, X7 is S, X8 is V, L, I or M and X9 is absent; or X1 and X7 are each V, X2 is W, X3 is Q, X4 is P, X5 is A, X6 is F, X8 is F, Y or W and X9 is absent or F, Y or W | 2001 Mar 20 | 2001 Sep 27 |
| WO03004650 | GROUP B STREPTOCOCCUS ANTIGENS AND CORRESPONDING DNA FRAGMENTS | MARTIN D;RIOUX S;BRODEUR B;HAMEL J;BOYER M; | SHIRE BIOCHEM INC.; | The present invention relates to antigens, more particularly antigens of Group B Streptococcus (GBS) (S.agalactiae) which may be useful to prevent, diagnose and/or treat streptococcal infections | 2002 Jul 5 | 2003 Jan 16 |
| WO03033644 | PEPTIDE USEFUL IN IMMUNOMODULATION | HARDY B;RAITER A;KLAPPER L; | CURE TECH LTD.;MOR-RESEARCH APPLICATIONS LTD.; | The present invention provides peptides and polynucleotides, and their use for immunomodulation, immunotherapy and vaccine particularly for anti-cancer therapy, and for diagnosis purposes. The immunomodulatory effect includes induction of proliferation and activation of peripheral blood lymphocytes and induction of an anti-tumor effect upon administration of peptides of the invention to subjects suffering from cancer | 2002 Oct 15 | 2003 Apr 24 |
| WO03037921 | IMMUNOINTERACTIVE MOLECULES AND USES THEREOF | O'HEHIR R; | COOPERATIVE RESEARCH CENTRE FOR ASTHMA; | The present invention relates generally to molecules such as peptides, polypeptides and proteins which interact immunologically with T lymphocytes in subjects having latex allergy and genetic sequences encoding same. These molecules are preferentially immunointeractive with T cells in subjects having a Hev b 6 allergy. The present invention also extends to antibodies, preferably monoclonal antibodies, directed to latex allergens and in particular to Hev b 6, and to the B cell epitopes recognised therein. The molecules of the present invention are useful in the development of diagnostic, therapeutic and prophylactic agents for conditions characterised by an aberrant, inappropriate or otherwise unwanted immune response to Hev b 6 or derivative or homologue thereof | 2002 Oct 30 | 2003 May 8 |
| WO92018150 | MHC CONJUGATES USEFUL IN AMELIORATING AUTOIMMUNITY | CLARK B;SHARMA S;LERCH B; | ANERGEN I;CLARK B;SHARMA S;LERCH B; | The present invention is directed to complexes consisting essentially of an isolated MHC component and an antigenic peptide associated with the antigen binding site of the MHC component. These complexes are useful in treating deletrious immune responses, such as autoimmunity | 1992 Apr 23 | 1992 Oct 29 |
| WO85004103 | SYNTHETIC HEPATITIS B VIRUS VACCINE INCLUDING BOTH T CELL ANC B CELL DETERMINANTS | MILICH D;CHISARI F; | SCRIPPS CLINIC AND RESEARCH FOUNDATION; | Chemically synthesized polypeptides include amino acid residue sequences that substantially correspond to the amino acid residue sequences of T cell and B cell determinant portions of a natural, pathogen-related protein, in particular, a hepatitis B virus surface antigen (HBsAg). When administered to a host alone, as polymers or as carrier-bound conjugates, the polypeptides induce the proliferation of thymus-derived cells in hosts primed against hepatitis B virus | 1985 Mar 6 | 1985 Sep 26 |
| WO86005189 | PROTEINACEOUS ANTIGENS WITH CONFORMATION-INDEPENDENT AND CONFORMATION-DEPENDENT DETERMINANTS | MILICH D;CHISARI F; | SCRIPPS CLINIC AND RESEARCH FOUNDATION; | A single polypeptide antigen that includes the amino acid residue sequence and epitope of a conformation-independent antigenic determinant and the amino acid residue sequence but lacks the epitope of a conformation-dependent antigenic determinant and methods of its manufacture and use and articles of manufacture using the same. The uses of the pre-S(2) region polypeptide encoded by the hepatitis B virus genome as a T cell proliferating agent and as a potentiator for enhancing the humoral immune response of animals that exhibit a low humoral response to an S region-containing immunogen are also disclosed | 1986 Mar 6 | 1986 Sep 12 |
| WO87007896 | T AND B CELL EPITOPES OF THE PRE-S REGION OF HEPATITIS B VIRUS SURFACE ANTIGEN | MILICH D;THORNTON G; | SCRIPPS CLINIC AND RESEARCH FOUNDATION; | Polypeptides corresponding in amino acid residue sequence to T and B cell epitopes in the pre-S region of HBsAg. A method of mitigating nonresponsiveness to an HBV vaccine comprising operatively linking a pre-S1 region T cell epitope to the immunogen of the vaccine is also disclosed | 1987 Jun 18 | 1987 Dec 30 |
| WO88009340 | A SV40 EXPRESSION VECTOR CONTAINING HBxAg AS AN EXPRESSION MARKER | MORIARTY A; | SCRIPPS CLINIC AND RESEARCH FOUNDATION; | Cloning and expression vectors for hepatitis B HBxAg, cell cultures containing those vectors, polypeptides related to HBxAg and diagnostic systems and methods for assaying for the presence of HBxAg and anti-HBxAg antibodies in a body sample are disclosed | 1988 May 24 | 1988 Dec 1 |
| WO88010300 | HETEROLOGOUS VIRAL PEPTIDE PARTICLE IMMUNOGENS | THOMA H; | MEDICO LABS AG;THOMA H; | An immunogenic particle comprises a plurality of first peptide monomers and a plurality of second peptide monomers, each of said first peptide monomers comprising: an amino acid sequence corresponding to a substantial portion of a peptide which upon secretion will form particles which are at least 10 nm in diameter, and an amino acid sequence corresponding to a heterologous epitope, each of said second peptide monomers comprising an amino acid sequence corresponding to a substantial portion of a peptide which upon secretion will form particles which are at least 10 nm in diameter, each of said second peptide monomers being free of an amino acid sequence corresponding to a heterologous epitope, wherein said first peptide monomer and said second peptide monomer are not identical but are capable of binding together | 1988 Jun 22 | 1988 Dec 29 |
| WO88010301 | HEPATITIS B SURFACE ANTIGEN VACCINE | THOMA H; | McCORMICK AND JONES ENGINEERING LTD.;THOMA H; | HBV surface antigen particles, prepared by recombinant DNA technology are described, said particles being composed of epitopes from the group of surface peptides and/or core peptide of non-A, non-B hepatitis virus, hepatitis virus A and/or hepatitis virus B. Respective particles are especially characterized by a composition of different epitopes selected from pre-S and S peptides. There are also described DNA-sequences, plasmids and cell lines coding for respective HBV surface antigen particles as well as a new vaccine containing the same | 1988 Jun 22 | 1988 Dec 29 |
| WO89002924 | VACCINES FOR MALARIA | BREY R;MAJARIAN W;PILLAI S;HOCKMEYER W; | PRAXIS BIOLOGICS I; | The present invention is directed to attenuated strains of enteroinvasive bacteria that express a peptide or protein related to an epitope of the malaria parasites of the genus Plasmodium. The bacterial strains of the invention which can multiply in a host without causing significant disease or disorder, and which express a Plasmodium-related peptide that induces a protective immune response against malaria, can be used in live vaccine formulations for malaria. In specific embodiments, a Plasmodium-related peptide can be expressed as a fusion protein, for example, with a bacterial enterotoxin. The invention also relates to methods for expression of malaria antigens or fragments thereof within attenuated enteroinvasive bacteria. In particular embodiments, the invention is directed to the expression by attenuated Salmonella spp. of epitopes of Plasmodium circumsporozoite proteins | 1988 Sep 30 | 1989 Apr 6 |
| WO89010967 | RECOMBINANT FLAGELLIN VACCINES | MARJARIAN W;STOCKER B;NEWTON S; | PRAXIS BIOLOGICS I;THE BOARD OF TRUSTEES OF THE LELAND STANDFORD .; | The present invention is directed to recombinant genes and their encoded proteins which are recombinant flagellin fusion proteins. Such fusion proteins comprise amino acid sequences specifying an epitope encoded by a flagellin structural gene and an epitope of a heterologous organism which is immunogenic upon introduction of the fusion protein into a vertebrate host. The recombinant genes and proteins of the present invention can be used in vaccine formulations, to provide protection against infection by the heterologous organism, or to provide protection against conditions or disorders caused by an antigen of the organism. In a specific embodiment, attenuated invasive bacteria expressing the recombinant flagellin genes of the invention can be used in live vaccine formulations. The invention is illustrated by way of examples in which epitopes of malaria circumsporozoite antigens, the B subunit of Cholera toxin, surface and presurface antigens of Hepatitis B, VP7 polypeptide of rotavirus, envelope glycoprotein of HIV, and M protein of Streptococcus, are expressed in recombinant flagellin fusion proteins which assemble into functional flagella, and which provoke an immune response directed against the heterologous epitope, in a vertebrate host | 1989 May 5 | 1989 Nov 16 |
| WO91017768 | EPITOPES OF THE PRE-S REGION OF HEPATITIS B VIRUS SURFACE ANTIGEN | MILICH D;THORNTON G; | SCRIPPS CLINIC AND RESEARCH FOUNDATION; | Polypeptides corresponding in amino acid residue sequence to native T cell epitopes in the pre-S (2) region of HBsAg are disclosed. A method of mitigating nonresponsiveness to HBsAg comprising including T cell epitopes of both the d and the y subtypes is also disclosed | 1991 May 10 | 1991 Nov 28 |
| WO92002243 | LIPOSOMES THAT PROVIDE THYMIC DEPENDENT HELP TO WEAK VACCINE ANTIGENS | SIX H;GARCON N; | RESEARCH DEVELOPMENT FOUNDATION; | The antibody response to a target antigen may be enhanced by incorporating the antigen into a liposome along with an additional constituent which contains at least one T-helper lymphocyte recognition site. The liposomes can include a wide variety of lipid materials. Both the antigen and the T-helper lymphocyte recognition site containing constituent may be associated with the liposome by using hydrophobic interactions or by covalent attachment to a lipid | 1991 Jul 24 | 1992 Feb 20 |
| WO92005192 | T-CELL EPITOPES | RUSSELL-JONES G;GECZY A; | BIOTECH AUSTRALIA PTY.LIMITED;RUSSELL-JONES G;GECZY A; | T-cell epitopes of or derived from the TraT protein of E. coli have been identified and used in the preparation of complexes with immunogens to enhance or provide immune responses to the immunogens. The complexes can be prepared either directly, by chemical linkage or as fusion proteins. Where the complexes are prepared as fusion proteins the invention provides for polynucleotides encoding the fusion proteins as well as transformant hosts capable of expressing the fusion proteins. The fusion proteins may be expressed either intracellularly or exported to and expressed on the surface of the transformant host | 1991 Sep 17 | 1992 Apr 2 |
| WO92010514 | SYNTHETIC ANTIGENS FOR THE DETECTION OF ANTIBODIES TO HEPATITIS C VIRUS | DELEYS R;POLLET D;MAERTENS G;VAN HEUVERSWIJN H; | INNOGENETICS NV;DELEYS R;POLLET D;MAERTENS G;VAN HEUVERSWIJN H; | Peptide sequences are provided which are capable of mimicking proteins encoded by HCV for use as reagents for screening of blood and blood products for prior exposure to HCV. The peptides are at least 5 amino acids long and can be used in various specific assays for the detection of antibodies to HCV, for the detection of HCV antigens, or as immunogens | 1991 Dec 13 | 1992 Jun 25 |
| WO92012992 | BASIC STRUCTURAL IMMUNOGENIC POLYPEPTIDES HAVING EPITOPES FOR HCV, ANTIBODIES, POLYNUCLEOTIDE SEQUENCES, VACCINES AND METHODS | KOTWAL G;BAROUDY B; | JAMES NG; | Novel basic immunogenic polypeptides having epitopes for HCV are disclosed. The novel basic immunogenic polypeptides are truncated polypeptides derived from the structural region of a human HCV isolate. Two preferred novel basic immunogenic polypeptides are designated as FGB1 and FGB2. The FGB1 and FGB2 polypeptides are believed to be derived from near the N- and C-terminals, respectively, of a putative (C) protein of HCV. In an ELISA, eight serum samples reactive for anti-C100 HCV antibody (EIA, Ortho/Chiron), recombinant immunoblot assay I (RIBA I, Ortho/Chiron) and neutralization (Neut., Abbot Labs.) contained antibodies to the FGB1 and FGB2 polypeptides. In addition, the FGB1 and FGB2 polypeptides and RIBA I were non-reactive with twelve serum samples which were reactive with EIA. Still further, two serum samples from a patient clinically diagnosed as NANBH, which were non-reactive with EIA and RIBA I, were reactive with FGB1 and/or FGB2. Novel polynucleotide sequences encoding the basic immunogenic polypeptides are also disclosed. The present invention further includes the application of these new sequences, polypeptides, and antibodies raised against the novel polypeptides in HCV detection, such as immunoassays, diagnostics, PCR technology and gene therapy. Included within the invention also are novel immunogenic HCV polypeptides encoded within recombinant expression systems and clones, novel transformants, novel probes, novel methods for producing the immunogenic HCV polypeptides, novel anti-idiotype antibodies, novel antisense polynucleotides, and novel kits | 1992 Jan 14 | 1992 Aug 6 |
| WO92017493 | PEPTIDES AND MIXTURES THEREOF FOR DETECTING ANTIBODIES TO HEPATITIS C VIRUS (HCV) | LACROIX M; | BIOCHEM PHARMA INC.; | This invention relates to novel peptides from the hepatitis C virus polyprotein amino acid regions 1-81, 101-127 and 210-231 and mixtures thereof useful for detecting HCV infections. These peptides are also useful as active ingredients in vaccines against HCV infection | 1992 Apr 3 | 1992 Oct 15 |
| WO92017612 | ASSAY FOR NON-A NON-B HEPATITIS | LEAHY D;TODD J;JOLLEY M;SHAH D;BETHELL D;ARIMA T; | BAXTER DIAGNOSTICS INC.; | New assays for diagnosing NANBH utilizing novel peptide fragments derived from polypeptide antigens reactive to antibodies present in the sera of infected patients are disclosed. In producing these peptides, the portion of polypeptide contributing to high backgrounds is deleted thereby resulting in assays with an exceptionally high signal to background ratio | 1992 Mar 26 | 1992 Oct 15 |
| WO92019263 | ORAL-INTESTINAL VACCINES AGAINST DISEASES CAUSED BY ENTEROPATHOGENIC ORGANISMS USING ANTIGENS ENCAPSULATED WITHIN BIODEGRADABLE-BIOCOMPATIBLE MICROSPHERES | REID R;JARBOE D;CASSELS F;BOEDEKER E;SETTERSTROM J; | THE UNITED STATES OF AMERICA arb; | This invention is directed to oral-intestinal vaccines and their use against diseases caused by enteropathogenic organisms using antigens encapsulated within biodegradable-biocompatible microspheres | 1991 May 13 | 1992 Nov 12 |
| WO92022571 | IMMUNOASSAY FOR NON-A NON-B HEPATITIS | LEAHY D;TODD J;JOLLEY M; | BAXTER DIAGNOSTICS INC.; | An assay for antigens of hepatitis C virus utilizes a synthetic peptide comprising the first 38 amino acids of the capsid region containing at least two immunodominant epitopes. The assay detects antibodies in the sera of patients infected with the Non-A Non-B hepatitis virus. Of particular efficacy is a competitive inhibition assay, which incorporates in the liquid phase an inhibitor consisting of a peptide containing only one of the immunodominant capsid epitopes, which is capable of inhibiting binding of antibodies to all target epitopes present on the solid substrate | 1992 Apr 29 | 1992 Dec 23 |
| WO93000365 | HEPATITIS C VIRUS (HCV) POLYPEPTIDES | CHIEN D;RUTTER W; | CHIRON CORPORATION; | HCV epitopes useful as immunogenic reagents, and corresponding antibodies and methods of use are disclosed | 1992 Jun 24 | 1993 Jan 7 |
| WO93001831 | INDUCTION OF CYTOTOXIC T-LYMPHOCYTE RESPONSES | RAYCHAUDHURI S;RASTETTER W; |
IDEC PHARMACEUTICALS CORPORATION; RAYCHAUDHURI S;RASTETTER W; |
Methods and compositions useful for inducing a cytotoxic T lymphocyte response (CTL) in a human or domesticated or agriculturally important animal. The method includes the steps of providing the antigen to which the CTL response is desired and providing an antigen formulation which comprises, consists, or consists essentially of two or more of a stabilizing detergent, a micelle-forming agent, and an oil. This antigen formulation is preferably lacking in an immunostimulating peptide component, or has sufficiently low levels of such a component that the desired CTL response is not diminished. This formulation is provided as a stable oil-in-water emulsion | 1992 Jul 24 | 1993 Feb 4 |
| WO93002103 | EPITOPES OF THE ENV PROTEIN OF THE HEPATITIS C VIRUS | ROSA C;GRIVA S;BONELLI F; | SORIN BIOMEDICA SPA;ROSA C;GRIVA S;BONELLI F; | Amino acid sequences having antigenic activity comprised in the sequence of the env protein of the virus HCV are disclosed; synthetic peptides having said sequences show an increased reactivity with anti-HCV sera when cyclized. Different variants of said sequences and nucleotide sequences coding for the sames are also disclosed | 1992 Jul 16 | 1993 Feb 4 |
| WO93002363 | METHOD TO DETECT ANTIBODIES AGAINST HEPATITIS C VIRUS AND KITS FOR THE USE THEREOF | ROSA C;GRIVA S;BONELLI F; | SORIN BIOMEDICA SPA;ROSA C;GRIVA S;BONELLI F; | An immunological method to detect antibodies that react with epitopes of the HCV virus env protein is disclosed. Said epitopes are preferentially cyclized | 1992 Jul 16 | 1993 Feb 4 |
| WO93003753 | PEPTIDES FOR INDUCING CYTOTOXIC T-LYMPHOCYTE RESPONSES TO HEPATITIS B VIRUS | CHISARI F;FERRARI C;PENNA A; | THE SCRIPPS RESEARCH INSTITUTE; | Peptides are used to define epitopes that stimulate HLA-restricted cytotoxic T lymphocyte activity against hepatitis B virus antigens. The peptides are derived from regions of HBV nucleocapsid, envelope, polymerase and the transcriptional transactivator X protein, and are particularly useful in treating or preventing HBV infection, including methods for stimulating the immune response of chronically infected individuals to respond to HBV antigens. Pharmaceutical compositions and hepatitis B vaccines which comprise the peptides and physiologically acceptable carriers can be employed in conjunction with other HBV vaccines to provide more effective immunity against the disease. Methods for identifying individuals who are particularly susceptible to developing chronic HBV infection and who can be targeted for treatment by the CTL peptides are also provided | 1992 Aug 26 | 1993 Mar 4 |
| WO93003764 | HLA-RESTRICTED HEPATITIS B VIRUS CTL EPITOPES | VITIELLO M;CHESNUT R; | CYTEL CORPORATION; | Cytotoxic T lymphocyte-stimulating peptides induce HLA-restricted responses to hepatitis B virus antigens. The peptides, derived from CTL epitopic regions of both HBV surface and nucleocapsid antigens, are particularly useful in the treatment and prevention of HBV infection, including the treatment of chronically infected HBV carriers. The peptides can be formulated as HBV vaccines and pharmaceutical compositions, such as lipid-containing compositions for enhancing the HLA-restricted CTL responses. The peptides are also useful in diagnostic methods, such as predicting which HBV-infected individuals are prone to developing chronic infection | 1992 Aug 26 | 1993 Mar 4 |
| WO93004087 | HEPATITIS C ASSAY UTILIZING RECOMBINANT ANTIGENS TO C-100 REGION | DESAI S;CASEY J;RUPPRECHT K;DEVARE S; | ABBOTT LABO; | The present invention provides unique recombinant antigens representing distinct antigenic regions of the HCV genome which can be used as reagents for the detection of antibodies and antigen in body fluids from individuals exposed to hepatitis C virus (HCV). The present invention also provides an assay for detecting the presence of an antibody to an HCV antigen in a sample by contacting the sample with the recombinant antigens. Preferred assay formats include a screening assay, a confirmatory assay, a competition or neutralization assay and an immunodot assay | 1992 Aug 21 | 1993 Mar 4 |
| WO93006126 | IMMUNOREACTIVE HEPATITIS C VIRUS POLYPEPTIDE COMPOSITIONS | WEINER A;HOUGHTON M; | CHIRON CORPORATION; | This invention relates generally to immunoreactive polypeptide compositions comprising hepatitis type C viral epitopes, methods of using the compositions in immunological applications, and materials and methods for making the compositions | 1992 Sep 11 | 1993 Apr 1 |
| WO93006247 | HEPATITIS C ASSAY | LESNIEWSKI R;LEUNG T; | ABBOTT LABO; | The present invention provides an improved assay for detecting the presence of an antibody to an HCV antigen in a sample by contacting the sample with at least one polypeptide containing at least one epitope of an HCV antigen. Preferred assay formats include a confirmatory assay, a combination assay, a synthetic polypeptide-based assay, an immunodot assay and a competition assay | 1992 Sep 16 | 1993 Apr 1 |
| WO93011158 | NON-A, NON-B PEPTIDES | HABETS W;HELLINGS J; | AKZO NV;HABETS W;HELLINGS J; | The invention concerns peptides which react immunochemically with antibodies directed aginst NANBH. The invention also relates to a method for the detection of NANBH or anti-NANBH in a test fluid and also to immunochemical reagents and a test kit to be used when applying the said detection methods | 1992 Dec 3 | 1993 Jun 10 |
| WO93013127 | PEPTIDES IMMUNOCHEMICALLY REACTIVE WITH ANTIBODIES DIRECTED AGAINST HEPATITIS NON-A, NON-B VIRUS | HABETS W;HELLINGS J; | AKZO NV;HABETS W;HELLINGS J; | The invention concerns peptides which react immunochemically with antibodies directed against HCV and nucleic acid sequences encoding these peptides. A method for the detection of HCV or anti-HCV antibodies in a test fluid, an immunochemical reagent and a testkit to be used when applying said detection methods also belong to the invention | 1992 Dec 24 | 1993 Jul 8 |
| WO93014116 | HEPATITIS E VIRUS PEPTIDE ANTIGENS AND ANTIBODIES | REYES G;BRADLEY D;TAM A;CARL M; | GENELABS TECHNOLOGIES I;THE GOVERNMENT OF THE UNITED STATES OF AMERICA as; | Immunogenic peptides derived from the ORF1, ORF2 and ORF3 regions of hepatitis E virus (HEV), diagnostic reagents containing the peptide antigens, vaccine compositions containing the antigens, and antibodies which are immunoreactive with the antigens are disclosed | 1993 Jan 15 | 1993 Jul 22 |
| WO93018054 | PROCESS FOR THE DETERMINATION OF PEPTIDES CORRESPONDING TO IMMUNOLOGICALLY IMPORTANT EPITOPES AND THEIR USE IN A PROCESS FOR DETERMINATION OF ANTIBODIES OR BIOTINYLATED PEPTIDES CORRESPONDING TO IMMUNOLOGICALLY IMPORTANT EPITOPES, A PROCESS FOR PREPARING THEM AND COMPOSITIONS CONTAINING THEM | DE LEYS R; | INNOGENETICS NV;DE LEYS R; | The technical problem underlying the present invention is to provide peptides corresponding to immunologically important epitopes on bacterial and viral proteins, as well as the use of said peptides in diagnostic or immunogenic compositions. The invention relates to a process for the in vitro determination of antibodies, wherein the peptides used are biotinylated, particularly in the form of complexes of streptavidin-biotinylated peptides or of avidin-biotinylated peptides | 1993 Mar 8 | 1993 Sep 16 |
| WO93025575 | PEPTIDE FOR STIMULATION OF CYTOTOXIC T LYMPHOCYTES SPECIFIC FOR HEPATITIS C VIRUS | BERZOFSKY J;SHIRAI M;AKATSUKA T;FEINSTONE S; | THE UNITED STATES OF AMERICA arb; | The cytotoxic T cell response to the protein encoded by the NS5 region of hepatitis C virus was determined using 28 peptides from NS5 which were selected by an amphipathicity algorithm as candidates for T cell epitopes. In BALB/c mice, a single relatively conserved epitope represented by a 16-residue synthetic peptide was presented by Dd class I major histocompatibility complex (MHC) molecules to conventional CD4-CD8+ CTL. An exemplary peptide, which represents amino acid residues 2422-2437 of the polyprotein of the Chiron HCV1 isolate, had the amino acid sequence MSYSWTGALVTPCAAE {SEQ ID NO: 1}. A CTL line specific for this peptide recognized the two known natural variants of this NS5 sequence, each with conservative substitutions. Thus, CTL can recognize the product of the HCV NS5 gene, the probable RNA polymerase, in association with class I MHC molecules on model target cells and may recognize the same epitope on hepatocytes or any other cells infected with the virus | 1993 Jun 10 | 1993 Dec 23 |
| WO94003205 | HLA BINDING PEPTIDES AND THEIR USES | KUBO R;GREY H;SETTE A;CELIS E; | CYTEL CORPORATION; | The present invention provides peptide compositions capable of specifically binding selected MHC alleles and inducing T cell activation in T cells restricted by the MHC allele. The peptides are useful to elicit an immune response against a desired antigen | 1993 Aug 6 | 1994 Feb 17 |
| WO94003208 | CONJUGATES OF POORLY IMMUNOGENIC ANTIGENS AND SYNTHETIC PEPTIDE CARRIERS AND VACCINES COMPRISING THEM | COHEN I;FRIDKIN M;KONEN-WAISMAN S; | YEDA RESEARCH AND DEVELOPMENT COMPANY LTD.;COHEN I;FRIDKIN M;KONEN-WAISMAN S; | The invention relates to conjugates of poorly immunogenic antigens, e.g. peptides, proteins and polysaccharides, with a synthetic peptide carrier constituting a T cell epitope derived from the sequence of human heat shock protein hsp65, or an analog thereof, said peptide or analog being capable of increasing substantially the immunogenicity of the poorly immunogenic antigen. Suitable peptides according to the invention are Pep278h, which corresponds to positions 458-474 of human hsp65, and Pep II, which corresponds to positions 437-448 of human hsp65, but in which two cysteine residues at positions 442 and 447 are replaced serine residues | 1993 Jul 28 | 1994 Feb 17 |
| WO94005311 | RETRO-, INVERSO-, AND RETRO-INVERSO SYNTHETIC PEPTIDE ANALOGUES | COMIS A;FISCHER P;TYLER M; | DEAKIN RESEARCH LIMITED;COMIS A;FISCHER P;TYLER M; | Synthetic peptide antigen analogues of native peptide antigens with partial or complete retro, inverso or retro-inverso modifications are provided. When administered as an immunogen to an immunocompetent host the synthetic peptide antigen analogues induce the production of antibodies which recognise the native peptide antigen. Uses of these analogues, vaccines and methods of preparing vaccines comprising these antigen analogues, and antibodies generated using these antigen analogues are also provided | 1993 Aug 27 | 1994 Mar 17 |
| WO94005698 | PEPTIDE SHOWING CROSS-REACTIVITY WITH THE ANTI-HEPATITIS B SURFACE ANTIGEN ANTISERUM | MANIVEL V;RAO K;PANDA S; | UNITED NATIONS INDUSTRIAL DEVELOPMENT .;MANIVEL V;RAO K;PANDA S; | The invention relates to a peptide showing cross-reactivity with anti-hepatitis B surface antigen (HBsAg) antiserum and comprising the 'a' epitope of HBsAg | 1993 Aug 30 | 1994 Mar 17 |
| WO94006826 | NOVEL BRANCHED HYBRID AND CLUSTER PEPTIDES EFFECTIVE IN DIAGNOSING AND DETECTING NON-A, NON-B HEPATITIS | WANG C;HOSEIN B; | UNITED BIOMEDICAL I; | The present invention relates to novel branched peptides specific for the diagnosis and prevention of non-A, non-B hepatitis (NANBH), as well as hepatitis C virus (HCV) infection. More particularly, the present invention is directed to branched synthetic substituted and hybrid peptides containing at least one epitope which is effective in detecting NANBH-associated antibodies in patients with NANBH using immunoassay techniques. In addition, this invention provides immunoassays and kits for the detection and diagnosis of NANBH or HCV infection using the subject peptides | 1993 Sep 15 | 1994 Mar 31 |
| WO94009032 | METHODS AND COMPOSITIONS FOR DETECTING ANTI-HEPATITIS E VIRUS ACTIVITY | FIELDS H;FAVOROV M;KHUDYAKOV Y; | UNITED STATES OF AMERICA arbT; | The present invention provides antigenic peptides and polypeptides of hepatitis E virus. Also provided are mixtures of conjugated and unconjugated peptides of the present invention. Methods of detecting hepatitis E viral infection in a subject using the peptides and peptide mixtures of the present invention are also contemplated | 1993 Oct 21 | 1994 Apr 28 |
| WO94013699 | HEPATITIS C VIRUS (HCV) NON-STRUCTURAL-3 PEPTIDES, ANTIBODIES THERETO AND METHODS FOR THE DETECTION OF HCV | HABETS W;BOENDER P; | AKZO NOBEL NV;HABETS W;BOENDER P; | The invention concerns peptides which react immunochemically with antibodies directed against HCV. A preferred peptide according to the invention comprises an HCV specific epitope of the NS-3 protein. The invention further relates to antibodies that specifically react with the NS-3 protein of HCV. Methods for the detection of HCV or HCV antibodies, and a method for the detection of antibodies specifically reactive with the NS-3 antigen are also part of the present invention | 1993 Dec 6 | 1994 Jun 23 |
| WO94014974 | MONOCLONAL ANTIBODIES AND ANTI-IDIOTYPIC ANTIBODIES TO HEPATITIS C VIRUS | HABETS W;OOSTERLAKEN T;MONDELLI M; | AKZO NOBEL NV;HABETS W;OOSTERLAKEN T;MONDELLI M; | The present invention relates to monoclonal antibodies specifically immunoreactive with hepatitis C viral antigens, cell lines secreting said antibodies, an immunodiagnostic reagent comprising the antibodies, and a method and test-kit for the detection of HCV. The present invention further relates to anti-idiotypic antibodies, cell lines secreting these anti-idiotypic antibodies, immunodiagnostic reagents comprising said anti-idiotypic antibodies and a test-kit for the detection of anti-HCV antibodies in a sample, using anti-idiotypic antibodies | 1993 Dec 27 | 1994 Jul 7 |
| WO94017192 | LYSOSOMAL TARGETING OF IMMUNOGENS | AUGUST J;PARDOLL D;GUARNIERI F; | THE JOHNS HOPKINS UNIVERSITY; | The inventors have discovered a targeting signal that will direct proteins to the endosomal/lysosomal compartment, and they have demonstrated that chimeric proteins containing a luminal antigenic domain and a cytoplasmic endosomal/lysosomal targeting signal will effectively target antigens to that compartment, where the antigenic domain is processed and peptides from it are presented on the cell surface in association with major histocompatibility (MHC) class II molecules. Chimeric DNA encoding the antigen of interst, linked to an endosomal/lysosomal targeting sequence, inserted in an immunization vector, can introduce the chimeric genes into cells, where the recombinant antigens are expressed and targeted to the endosomal/lysosomal compartment. As a result, the antigens associate more efficiently with MHC class II molecules, providing enhanced in vivo stimulation of CD4+ T cells specific for the the recombinant antigen. Delivering antigens to an endosomal/lysosomal compartment by means of chimeric constructs containing such lysosomal targeting signals will be of value in any vaccination or immunization strategy that seeks to stimulate CD4+ MHC class II restricted immune responses | 1994 Jan 21 | 1994 Aug 4 |
| WO94019011 | PEPTIDES FOR INDUCING CYTOTOXIC T LYMPHOCYTE RESPONSES TO HEPATITIS B VIRUS | CHISARI F; | THE SCRIPPS RESEARCH INSTITUTE;CHISARI F; | Peptides are used to define epitopes that stimulate HLA-restricted cytotoxic T lymphocyte activity against hepatitis B virus antigens. The peptides are derived from regions of HBV envelope, and are particularly useful in treating or preventing HBV infection, including methods for stimulating the immune response of chronically infected individuals to respond to HBV antigens | 1994 Feb 25 | 1994 Sep 1 |
| WO94025483 | IMMUNOTHERAPEUTIC PEPTIDES DERIVED FROM TOXIC SHOCK SYNDROME TOXIN-1, ANTIBODIES THERETO, THEIR USES IN PHARMACEUTICAL COMPOSITIONS AND DIAGNOSIS | CHOW A;KUM W; | THE UNIVERSITY OF BRITISH COLUMBIA;CHOW A;KUM W; | The invention provides immunogenic peptides, antibodies which bind the peptides, and immunodiagnostic and immunotherapeutic methods using the peptides. In addition, the invention provides antibodies for the diagnosis and treatment of immunopathological disease such as those associated with superantigens | 1994 May 3 | 1994 Nov 10 |
| WO94025594 | CLONING, EXPRESSION AND VACCINE COMPOSITION CORRESPONDING TO A PEPTIDE ANTIGEN OF TOXOPLASMA GONDII | BIEMANS R;BOLLEN A;JACOBS P; | SMITHKLINE BEECHAM BIOL;BIEMANS R;BOLLEN A;JACOBS P; | The invention provides a polypeptide corresponding to residues 197 - 216 of the 54 KDa antigen of T. gondii, having the amino acid sequence TDPGDVVIEELFNRIPETSV. Also within the scope of the invention is a method of producing the 54 KD antigen of T. gondii or the polypeptide corresponding to residues 197 - 216 thereof by expression from a host cell, for example from a host cell comprising a vaccinia virus or from a CHO cell | 1994 Apr 26 | 1994 Nov 10 |
| WO94025602 | HEPATITIS-C VIRUS TYPE 4, 5 AND 6 | SIMMONDS P;YAP P;PIKE I; | COMMON SERVICES AGENCY;MUREX DIAGNOSTICS LTD.;SIMMONDS P;YAP P;PIKE I; | Newly elucidated sequences of hepatitis C virus type 4 and type 5 are described, together with those of a newly discovered type 6. Unique type-specific sequences in the NS4, NS5 and core regions enable HCV detection and genotyping into types 1 to 6. Antigenic peptides and immunoassays are described | 1994 May 5 | 1994 Nov 10 |
| WO94025874 | DIAGNOSTIC KIT AND METHOD FOR THE SIMULTANEOUS DIAGNOSIS OF HEPATITIS B AND C | CHO J;CHOI D;KIM C;SO H;YANG J;KIM I;CHOI D; | LUCKY LIMITED;CHO J;CHOI D;KIM C;SO H;YANG J;KIM I;CHOI D; | The present invention relates to a diagnostic kit for the simultaneous diagnosis of hepatitis B and hepatitis C and a diagnostic method therefor by employing said diagnostic kit; and, more specifically, to a diagnostic kit for the simultaneous diagnosis of hepatitis B and C comprising a hepatitis B and a hepatitis C viral antigens together, and a diagnostic method utilizing said kit | 1994 Apr 27 | 1994 Nov 10 |
| WO94026306 | CONSERVED MOTIF OF HEPATITIS C VIRUS E2/NS1 REGION | WEINER A;HOUGHTON M; | CHIRON CORPORATION; | The hypervariable region (E2HV) of the putative hepatitis C virus (HCV) glycoprotein E2/NS1, between about amino acid 384 to about amino acid 414, is a rapidly evolving region of HCV, and is likely to be under positive immune selection. A newly discovered motif within this hypervariable region is immunogenic and conserved with respect to the character of the amino acids. In many isolates, this motif falls between amino acids 401 to 406 or 407. The discovery of this motif allows for additional materials and methods to treat and diagnose HCV | 1994 May 3 | 1994 Nov 24 |
| WO94026774 | NOVEL TREATMENTS FOR ALLERGIC DISEASES | ALEXANDER J;FRANCO A;GREY H;SETTE A; | CYTEL CORPORATION; | The present invention provides novel peptides for treating allergic diseases such as celiac disease. The peptides bind MHC glycoproteins associated with celiac disease and block T cell activation associated with the disease. The peptides may block MHC-antigenic peptide complex formation. Alternatively, the peptides may be T cell antagonist peptides and form inhibitory complexes which competitively inhibit binding between MHC-antigenic peptide complexes which induce activation of T cells associated with celiac disease. Methods for identifying peptides of the present invention are also disclosed | 1994 May 19 | 1994 Nov 24 |
| WO92017590 | THERAPEUTIC AND PREVENTIVE VACCINES FOR HIV | RUBINSTEIN A;BLOOM B;DEVASH Y;CRYZ S; | IMPFINSTITUT BERN;ALBERT EINSTEIN COLLEGE OF MEDICINE OF YESHIVA .; | This invention relates to conjugates of peptides with amino acid sequences similar to the gp120 PND of HIV and carriers which enhance immunogenicity, such conjugates to be used in vaccines for the treatment and transmission prevention of HIV. After vaccination with the conjugates, antibody-containing fluid is extracted from individuals and assessed in an antigen-limited ELISA which contains a thimerosal-containing diluent and selects for high affinity/avidity neutralizing and/or protective HIV-specific antibodies. The conjugates which have induced the production of such antibodies are useful in the treatment and transmission prevention of HIV | 1992 Apr 2 | 1992 Oct 15 |
| WO95000670 | LINEAR AND BRANCHED PEPTIDES EFFECTIVE IN DIAGNOSING AND DETECTING NON-A, NON-B HEPATITIS | WANG C;HOSEIN B; | UNITED BIOMEDICAL I; | The present invention relates to novel linear and branched peptides specific for the diagnosis and prevention of non-A, non-B hepatitis (NANBH), as well as hepatitis C virus (HCV) infection. More particularly, the present invention is directed to linear peptides diagnostic for NS-3 of HCV as well as branched synthetic substituted and hybrid peptides containing at least one epitope which is effective in detecting NANBH-associated antibodies in patients with NANBH using immunoassay techniques. In addition, this invention provides immunoassays for the detection and diagnosis of NANBH using the subject peptides, vaccine compositions for prevention and treatment of NANBH of HCV infection as well as a method of treating or preventing NANBH and HCV infection | 1994 Jun 22 | 1995 Jan 5 |
| WO95002070 | CONFIRMATORY ASSAY AND REAGENTS FOR HEPATITIS E VIRUS | DAWSON G;GUTIERREZ R;PAUL D;KNIGGE M; | ABBOTT LABO; | An assay, reagents and a test kit useful for detecting the presence of anti-HEV antibody which may be present in a test sample. The assay method comprises (a) contacting the test sample with at least one synthetic peptide which specifically binds anti-HEV antibody, for a time and under conditions sufficient to form peptide/antibody complexes; (b) contacting said peptide/antibody complexes with an indicator reagent which comprises a signal generating compound attached to an anti-human antibody, and incubating for a time and under conditions sufficient for peptide/antibody/antibody complexes to form; and (c) detecting a measurable signal to indicate the presence of anti-HEV in the test sample | 1994 Jun 28 | 1995 Jan 19 |
| WO95003429 | IMMUNOASSAY PROCEDURE UTILIZING FLUOROGENIC TRACER ANTIGENS | WEI AP;HERRON J; | UNIVERSITY OF UTAH RESEARCH FOUNDATION; | Fluorescent energy transfer dyes capable of moving between a more stacked configuration to exhibit fluorescent quenching and a more spaced configuration to exhibit fluorescence can be conjugated to a peptide epitope or nucleic acid for use in the detection of an unknown antibody in bulk solution. The resulting labelled peptide reagent can be used in an immunoassay procedure by placing it in bulk solution along with the unknown antibody to be detected. When the antibody binds to the peptide epitope, the pair of dyes carried by the peptide epitope will have their configuration altered from a stacked to an unstacked configuration and will exhibit a fluorescent increase in response thereto | 1994 Jul 22 | 1995 Feb 2 |
| WO95004817 | METHODS FOR EX VIVO THERAPY USING PEPTIDE-LOADED ANTIGEN PRESENTING CELLS FOR THE ACTIVATION OF CTL | CELIS E;KUBO R;SERRA H;TSAI V;WENTWORTH P; | CYTEL CORPORATION; | Methods for activating cytotoxic T lymphocytes (CTL) in vitro are presented in conjunction with methods for using the activated CTL for therapy in vivo. Additionally, a method for killing specific CTL in vivo is presented using antigen presenting cells which were modified in vitro | 1994 Aug 1 | 1995 Feb 16 |
| WO95012677 | IMMUNODOMINANT HUMAN T-CELL EPITOPES OF HEPATITIS C VIRUS | LEROUX-ROELS G;DELEYS R;MAERTENS G; | INNOGENETICS NV;LEROUX-ROELS G;DELEYS R;MAERTENS G; | The present invention relates to a polypeptide of about 8 to about 100 amino acids comprising or consisting of at least 8 contiguous amino acids selected from the core, and/or the E1, and/or E2, and/or the NS3 regions of the HCV polyprotein, with said contiguous amino acids containing a T-cell stimulating epitope | 1994 Oct 28 | 1995 May 11 |
| WO95016704 | HEPATITIS B VIRUS PEPTIDES | LEROUX-ROELS G;SLAOUI M;HAUSER P; | SMITHKLINE BEECHAM BIOLOGICALS SA;LEROUX-ROELS G;SLAOUI M;HAUSER P; | A synthetic peptide (or close analogue thereof) which is part of the natural sequence of hepatitis B surface antigen is chosen from the following (AA indicates amino acid number): AA 211-222, AA 316-333, AA 361-378. Also provided are derivatives of the above in which the peptide is conjugated to a hepatitis B virus T-cell epitope of forms part of a fusion protein or is conjugated to an non-immunogenic oligo- or polysaccharide or lipid. Vaccines comprising the above peptides or conjugates are also provided, together with a method of immunising or treating individuals suffering from viral disease | 1994 Dec 13 | 1995 Jun 22 |
| WO95018382 | A DIAGNOSTIC ANTIGEN AND A METHOD OF IN VITRO DIAGNOSING AN ACTIVE INFECTION CAUSED BY HEPATITIS C VIRUS | SALLBERG M;TROJNAR J; | EURO-DIAGNOSTICA AB;SALLBERG M;TROJNAR J; | A peptide of the formula (SEQ ID NO:1) Met Ser Thr Asn Pro Lys Pro Cys Arg Lys Thr Lys Arg Asn Thr Asn Arg Arg Pro Cys Asp Val Lys Phe Pro Gly Gly Gly, wherein there is a disulfide bridge between the two cysteine residues, is described. Further, a diagnostic antigen in carrier-bound form comprising said peptide is disclosed. Said peptide may be used in a method of in vitro diagnosing an active infection caused by hepatitis C virus | 1994 Dec 8 | 1995 Jul 6 |
| WO95023166 | SYNTHETIC INVERSO OR RETRO-INVERSO T-CELL EPITOPES | COMIS A;TYLER M;FISCHER P; | DEAKIN RESEARCH LIMITED;COMIS A;TYLER M;FISCHER P; | Synthetic T cell epitope analogues of native T cell epitopes which are partially or completely inverso or retro-inverso modified with respect to the native T cell epitope are shown to be effective as T cell epitopes. These T cell epitope analogues stimulate immune responsiveness when used in place of their native T cell epitope counterparts in vaccines. The invention further relates to the use of these T cell epitope analogues, to vaccines comprising the T cell epitope analogues, to methods of preparing vaccines comprising these T cell epitope analogues, and to antibodies generated using these T cell epitope analogues | 1995 Feb 24 | 1995 Aug 31 |
| WO95025122 | PEPTIDES FOR INDUCING CYTOTOXIC T LYMPHOCYTE RESPONSES TO HEPATITIS C VIRUS | CHISARI F;CERNY A; | THE SCRIPPS RESEARCH INSTITUTE; | The present invention is directed to a molecule comprising a polypeptide having substantial homology with a CTL epitope selected from the group consisting of ADLMGYIPLV (Core131-140; SEQ ID NO:1), LLALLSCLTV (Core178-187; SEQ ID NO:2), QLRRHIDLLV (SEQ ID NO:55), LLCPAGHAV (NS31169-1177; SEQ ID NO:26), KLVALGINAV (NS31406-1415; SEQ ID NO:28), SLMAFTAAV (NS41789-1797; SEQ ID NO:34), LLFNILGGWV (NS41807-1816; SEQ ID NO:35), and ILDSFDPLV (NS52252-2260); SEQ ID NO:42). Such molecules are used for the treatment and prevention of acute or chronic HCV hepatitis; suitable pharmaceutical compositions and methods using such compositions are disclosed | 1995 Mar 16 | 1995 Sep 21 |
| WO95031994 | PEPTIDES USED AS CARRIERS IN IMMUNOGENIC CONSTRUCTS SUITABLE FOR DEVELOPMENT OF SYNTHETIC VACCINES | COHEN I;FRIDKIN M;KONEN-WAISMAN S; | YEDA RESEARCH AND DEVELOPMENT CO.LTD.;COHEN I;FRIDKIN M;KONEN-WAISMAN S; | The invention relates to conjugates of poorly immunogenic antigens, e.g., peptides, proteins and polysaccharides, with a synthetic peptide carrier constituting a T cell epitope derived from the sequence of E. coli hsp65 (GroEL), or an analog thereof, said peptide or analog being capable of increasing substantially the immunogenicity of the poorly immunogenic antigen. A suitable peptide according to the invention is Pep287e, which corresponds to positions 437-453 of the E. coli hsp65 molecule | 1995 May 24 | 1995 Nov 30 |
| WO96003140 | HLA binding peptides and their uses | SETTE A;SIDNEY J; | CYTEL CORPORATION; | The present invention provides peptide compositions capable of binding glycoproteins encoded by HLA, HLA-B, and HLA-C alleles and inducing T cell activation in T cells restricted by the HLA allele. The peptides are useful to elicit an immune response against a desired antigen | 1995 Jul 21 | 1996 Feb 8 |
| WO96019495 | METHODS AND COMPOSITIONS FOR INHIBITION OF MEMBRANE FUSION-ASSOCIATED EVENTS, INCLUDING HIV TRANSMISSION | BOLOGNESI D;MATTHEWS T;WILD C;BARNEY S;LAMBERT D;PETTEWAY S;LANGLOIS A; | DUKE UNIVERSITY;TRIMERIS INC.; | The present invention relates to peptides which exhibit potent anti-retroviral activity. The peptides of the invention comprise DP178 (SEQ ID:1) peptide corresponding to amino acids 638 to 673 of the HIV-1LAI gp41 protein, and fragments, analogs and homologs of DP178. The invention further relates to the uses of such peptides as inhibitory of human and non-human retroviral, especially HIV, transmission to uninfected cells | 1995 Dec 20 | 1996 Jun 27 |
| WO96020953 | SYNTHETIC MULTIMERIC PEPTIDE WITH DELTA HEPATITIS VIRUS ANTIGENIC ACTIVITY | LEMON S;ERICKSON B;WANG J;ROZZELLE J; | THE UNIVERSITY OF NORTH CAROLINA AT CHAPEL HILL;LEMON S;ERICKSON B;WANG J;ROZZELLE J; | Synthetic peptides exhibit delta hepatitis virus antigenic activity and self-assembly that results in the formation of large multimers and display of a conformational epitope. The peptides may be used to confer protective immunity in subjects or to raise antibodies for diagnostic purposes. Diagnostic assays and kits for diagnostic assays utilize these peptides | 1995 Dec 22 | 1996 Jul 11 |
| WO96040225 | IMMUNOGENIC AND IMMUNOSTIMULATORY OLIGOSACCHARIDE COMPOSITIONS AND METHODS OF MAKING AND USING THEM | MALCOLM A; | ALBERTA RESEARCH COUN;MALCOLM A; | The invention provides immunogenic oligosaccharide compositions and methods of making and using them. In particular, the compositions comprise oligosaccharides covalently coupled to carrier protein, wherein the resultant conjugate has been shown to contain specific immunogenic epitopes and elicits a protectively immunogenic response. This invention also provides compositions comprising an oligosaccharide of S. pneumoniae serotype 8 useful for stimulating an immune response to an antigen, methods of providing protective immunization against a bacterial pathogen using these compositions, methods of augmenting an immunogenic response to an antigen by administering these S. pneumoniae serotype 8 oligosaccharide compositions along with the antigen, and methods of making the immunostimulatory compositions described above | 1996 Jun 6 | 1996 Dec 19 |
| WO97027300 | TOXOPLASMA GONDII ANTIGEN Tg20 | JACOBS D;SAMAN E;VAN HEUVERSWYN H; | INNOGENETICS NV; | The present invention relates to isolated and pure Toxoplasma gondii antigenic fragments, recombinant polypeptides, nucleic acids encoding them, primers and probes derived from the same, as well as the use of these polypeptides, nucleic acids, primers and probes in methods and kits for the diagnosis and prevention of T. gondii infection in mammals (humans and animals) | 1997 Jan 27 | 1997 Jul 31 |
| WO97027486 | REAGENTS FOR USE AS CALIBRATORS AND CONTROLS | HACKETT J;HOFF J;OSTROW D;GOLDEN A; | ABBOTT LABO; | The present invention relates to the use of a reagent that binds specifically to a predetermined ligand, contains one or more antibody constant region epitopes, and is uniform in specificity and affinity. The reagent can be produced continually, in the manufacture of calibrators (standards) and/or controls for diagnostic kits designed to qualitatively or quantitatively measure antibodies specific for a desired ligand. For example, the present invention encompasses recombinant mouse-human chimeric antibodies which may be used as calibrators (standards) and/or positive controls in assays and kits which measure human antibodies. Any species may be used in creating the chimeric antibodies, and the presence of any corresponding species of antibody may be detected | 1997 Jan 17 | 1997 Jul 31 |
| WO97033602 | PEPTIDES WITH INCREASED BINDING AFFINITY FOR HLA MOLECULES | SETTE A;CHESTNUT R;SIDNEY J; | CYTEL CORPORATION; | Ther present invention provides immunogenic peptides comprising an HLA-A3 supermotif. The peptides can be used to treat, diagnose, or monitor a number of pathological conditions | 1997 Mar 10 | 1997 Sep 18 |
| WO97034617 | HLA BINDING PEPTIDES AND THEIR USES | KUBO R;GREY H;SETTE A;CELIS E; | CYTEL CORPORATION; | The present invention provides peptide compositions capable of specifically binding selected MHC alleles and inducing T cell activation in T cells restricted by the MHC allele. The peptides are useful to elicit an immune response against a desired antigen | 1997 Mar 21 | 1997 Sep 25 |
| WO97034621 | HLA-A2.1 BINDING PEPTIDES AND THEIR USES | GREY H;SETTE A;SIDNEY J; | CYTEL CORPORATION; | The present invention provides the means and methods for selecting immunogenic peptides and the immunogenic peptide compositions capable of specifically binding glycoproteins encoded by HLA-A2.1 allele and inducing T cell activation in T cells restricted by the A2.1 allele. The peptides are useful to elicit an immune response against a desired antigen | 1997 Mar 21 | 1997 Sep 25 |
| WO97035008 | METHODS AND COMPOSITIONS OF CHIMERIC POLYPEPTIDES FOR TUMOR ANTIGEN VACCINES | KWAK L;BIRAGYN A; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbtSDOHAHS; | The present invention provides a chimeric polypeptide comprising a hepatitis B virus core antigen (HBcAg) region and a region comprising an epitope of a tumor antigen. The present invention further provides a nucleic acid encoding the chimeric polypeptide, a vector comprising the nucleic acid and a cell comprising the vector. Also provided is a method of inhibiting the growth of tumor cells in a subject, comprising administering to the subject a tumor cell growth-inhibiting amount of a chimeric polypeptide comprising a HBcAg region and a region comprising an epitope of a tumor antigen corresponding to a tumor antigen in the subject. A chimeric polypeptide comprising a hepatitis B virus core antigen region and an antigenic polypeptide region comprising greater than 40 amino acids, which assembles into core particles, is also provided, as well as a method for constructing a chimeric polypeptide comprising a hepatitis B virus core antigen region and an antigenic polypeptide region comprising greater than 40 amino acids, which assembles into core particles, comprising cloning into an expression vector a first DNA fragment encoding the hepatitis B core antigen region and a second DNA fragment encoding an antigenic polypeptide region greater than 40 amino acids; and expressing the DNA of the expression vector in an expression system whereby the chimeric polypeptide assembles into core particles | 1997 Mar 21 | 1997 Sep 25 |
| WO97039029 | AN ANTIGENIC EPITOPE OF THE A DETERMINANT OF HEPATITIS B SURFACE ANTIGEN AND USES THEREOF | BRIDON D;QIU X; | ABBOTT LABO; | The subject invention relates to a peptide sequence corresponding to amino acid residues (117 to 128) of hepatitis B surface antigen and uses thereof. In particular, the peptide is an antigenic epitope and may therefore be used, for example, as a diagnostic reagent or in the production of a vaccine. Furthermore, the present invention also relates to a C(K/R)TC motif present within the peptide as well as to other peptides containing this motif | 1997 Apr 18 | 1997 Oct 23 |
| WO97044469 | MULTIPLE EPITOPE FUSION PROTEIN | VALENZUELA P;CHIEN D; | CHIRON CORPORATION; | Multiple copy epitope immunoassays are produced by: (1) identifying nucleotide sequences that encode a plurality of different epitopes; (2) placing the nucleotide sequences into an expression cassette wherein at least two copies of a sequence coding for the same epitope, preferably from different strains of a pathogen, are placed in the cassette; (3) transforming a suitable host with the cassette in order to express the sequences encoding the epitopes; (4) purifying the expressed epitopes; and (5) coating the epitopes on a surface of a substrate. The purified epitopes are encompassed by the general structural formula (A)x-(B)y-(C)z which represents a linear amino acid sequence, B is an amino acid sequence of an epitope or cluster of epitopes and each B contains at least five and not more than 1,000 amino acids, y is an integer of 2 or more, A and C are each independently an amino acid sequence of an epitope or cluster of epitopes not adjacent to B in nature and x and z are each independently an integer of 0 or more wherein at least one of x and z is 1 or more. The epitopes of the invention are more soluble than and are therefore more easily purified than conventional epitopes. Further, the presence of repeating epitope sequences (repeating at least B in the same linear amino acid sequence from different strains of a pathogen) increases the sensitivity and specificity of the assay. Repeated epitope sequences in a single linear antigen also decreases masking problems and makes it possible to include a greater number of epitopes on a unit area of substrate thereby improving sensitivity in the detection of antibodies | 1997 May 23 | 1997 Nov 27 |
| WO98007320 | NEUTRALIZATION-SENSITIVE EPITOPES OF CRYPTOSPORIDIUM PARVUM | PERRYMAN L;JASMER D;RIGGS M;McGUIRE T; | NORTH CAROLINA STATE UNIVERSITY; | DNA sequences encoding epitopes to which sporozoite-neutralizing antibodies are directed are provided. Recombinant proteins and synthetic peptides containing Cryptosporidium parvum epitopes for inducing an antigenic response are described | 1997 Aug 22 | 1998 Feb 26 |
| WO98022145 | IMMUNIZATION OF INFANTS | BOT A;BONA C; | MOUNT SINAI SCHOOL OF MEDICINE OF THE CITY UNIVERSITY OF NEW YORK; | The present invention relates to methods and compositions which may be used to immunize infant mammals against a target antigen, wherein an immunogenically effective amount of a nucleic acid encoding a relevant epitope of a desired target antigen is administered to the infant. It is based, at least in part, on the discovery that such genetic immunization of infant mammals could give rise to effective cellular and humoral immune responses against target antigens | 1997 Nov 21 | 1998 May 28 |
| WO98023960 | ASSAY METHOD FOR PEPTIDE SPECIFIC T.ndash.CELLS | LALVANI A;BROOKES R; | ISIS INNOVATION LIMITED; | A method of assaying for peptide-specific T-cells comprises adding peptide to a fluid sample of fresh peripheral blood mononuclear cells, and detecting a cytokine such as interferon-'gamma' produced by T-cells that have been pre-sensitised to the peptide. The assay method is quick and cheap and is expected to be useful for the study of various disease states including Hepatitis B, Hepatitis C, tuberculosis, malaria, HIV and influenza | 1997 Nov 25 | 1998 Jun 4 |
| WO98029442 | ANNEXIN V.ndash.BINDING POLYPEPTIDES DERIVED FROM HBsAg AND THEIR USES | DEPLA E;MAERTENS G;YAP SH;DE MEYER S; | INNOGENETICS NV; | Polypeptides derived from hepatitis B surface antigen which are able to compete with the hepatitis B surface antigen/annexin V interaction, or which are able to bind a compound or antibody competing with the hepatitis B surface antigen/annexin V interaction are described. The use of these polypeptides, and antibodies against them, in order to diagnose, treat and vaccinate against an infection with hepatitis B virus and/or hepatitis delta virus is also disclosed | 1997 Dec 23 | 1998 Jul 9 |
| WO98032456 | IDENTIFICATION OF BROADLY REACTIVE DR RESTRICTED EPITOPES | SETTE A;SIDNEY J;SOUTHWOOD S; | EPIMMUNE I; | The present invention is based on peptide binding specificities of HLA DR4w4, DR1 and DR7. Peptides binding to these DR molecules have a motif characterized by a large aromatic or hydrophobic residue in position 1 (Y, F, W, L, I, V, M) and a small, non charged residue in position 6 (S, T, C, A, P, V, I, L, M). In addition, allele-specific secondary effects and secondary anchors are defined, and these results were utilized to derive allele specific algorithms. By the combined use of such alogirthms peptides capable of degenerate DR1, 4, 7 binding were identified | 1998 Jan 23 | 1998 Jul 30 |
| WO98033523 | VACCINATION METHODS AND MOLECULES | CARR F;CARTER G; | BIOVATION LIMITED; | A molecule comprising 1) a nucleic acid portion from which at least one peptide for presentation on MHC class I or class II molecules, or both, may be derived and 2) a polypeptide portion, from which at least one peptide for presentation on MHC class I or class II molecules, or both, is provided. Such hybrid vaccine molecules give rise to enhanced immune responses, or to modulation of the response to the antigens which may be derived from these molecules. The combination of nucleic acid and polypeptides in the same molecule may give rise not only to a combination of MHC class I- and MHC class II-mediated immune responses but also to an enhancement of these responses compared to the responses given by either nucleic acid or polypeptide alone. The molecules may comprise Fc antibody domains which may enhance uptake of the molecules by antigen presenting cells | 1998 Feb 2 | 1998 Aug 6 |
| WO98033888 | PEPTIDES AND PEPTIDE.ndash.LOADED ANTIGEN PRESENTING CELLS FOR THE ACTIVATION OF CTL | TSAI V;SOUTHWOOD S;SIDNEY J;SETTE A;CELIS E; | EPIMMUNE I; | Methods for generating antigen-specific cytotoxic T lymphocytes (CTLs) in vitro are presented in conjuntion with methods for using these CTLs for therapy in vivo. The antigen presenting cells (APCs) used herein notably include dentritic cells pretreated with GM-CSF and IL-4. Antigen-specific CTLs were obtained by incubating CD8 preparations in the presence of APCs that bound desired peptides. IL-7 was generally added at day 1 of the incubation; IL-10 was generally added one day later and during restimulation. The invention also comprises methods for using peptide pulsed dentritic cells to identify novel MHC Class I-restricted tumor antigens and subdominant epitopes | 1998 Jan 30 | 1998 Aug 6 |
| WO98043677 | MULTIPLE ANTIGEN GLYCOPEPTIDE CARBOHYDRATE, VACCINE COMPRISING THE SAME AND USE THEREOF | BAY S;CANTACUZENE D;LECLERC C;LO-MAN R; | INSTITUT PAST; | A carbohydrate peptide conjugate comprising: a carrier comprising a dendrimeric poly-Lysine enabling multiple epitopes to be covalently attached thereto, at least one peptide comprising one T epitope or several identical or different T epitopes, at least one carbohydrate moiety, or a derivative thereof, containing B epitope, provided it is not a sialoside, or several identical or different epitopes. Use of this conjugate for inducing immune response | 1998 Mar 27 | 1998 Oct 8 |
| WO99005169 | EPITOPES OF SHIGELLA LIKE TOXIN AND THEIR USE AS VACCINE AND IN DIAGNOSIS | BURNIE J;MATTHEWS R; | NEUTEC PHARMA PLC; | The present invention concerns immunogenic epitopes of Shigella-like toxins (SLTs), particularly the Shigella-like toxin of i(E.coli) O157:H7, their use as immunogens and in treatment or diagnosis, agents (for example antibodies and antigen-binding fragments) which specifically neutralise them, their use in treatment and diagnosis, and methods for same | 1998 Jul 17 | 1999 Feb 4 |
| WO99010506 | MOSAIC PROTEIN AND RESTRICTION ENDONUCLEASE ASSISTED LIGATION METHOD FOR MAKING THE SAME | KHUDYAKOV Y;FIELDS H; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbTSOTDOHAHS; | A mosaic protein comprising a variety of immunoreactive antigenic epitopes from several genotypes of hepatitis C virus. The mosaic protein provides a sensitive and specific immunological hepatitis detection assay. A restriction enzyme assisted ligation method of making an artificial gene permits controlled construction of mosaic proteins, and allows confirmatory expression of the intermediate gene products | 1998 Aug 21 | 1999 Mar 4 |
| WO99045954 | HLA.ndash.BINDING PEPTIDES AND THEIR USES | SETTE A;KUBO R;SIDNEY J;CELIS E;GREY H;SOUTHWOOD S; | EPIMMUNE I; | The present invention provides the means and methods for selecting immunogenic peptides and the immunogenic peptide compositions capable of specifically binding glycoproteins encoded by HLA allele and inducing T cell activation in T cells restricted by the allele. The peptides are useful to elicit an immune response against a desired antigen | 1998 Mar 13 | 1999 Sep 16 |
| WO99055730 | POLYEPITOPE CARRIER PROTEIN | RAPPUOLI R;GRANDI G; | CHIRON SPA; | The invention relates to polyepitope carrier proteins that comprise at least five CD4+ T cell epitopes, for conjugation to capsular polysaccharides. The carrier proteins are use useful as components of vaccines that can elicit a T-cell dependent immune response. These vaccines are particularly useful to confer protection against infection from encapsulated bacteria in infants between the ages of 3 months and about 2 years | 1999 Apr 27 | 1999 Nov 4 |
| WO00044775 | IDENTIFICATION OF BROADLY REACTIVE HLA RESTRICTED T CELL EPITOPES | SETTE A;SIDNEY J; | EPIMMUNE INC.; | This application discloses five new amino acid supermotifs and corresponding grouping of HLA molecules (i(i.e.), HLA supertypes that bind peptides that bear these supermotifs). Peptides epitopes bearing these supermotifs are selected for use in vaccines and other pharmaceutical compositions. The new supermotifs are used to screen known disease-related targets, as well as targets that will be determined in the future | 2000 Jan 26 | 2000 Aug 3 |
| WO00076537 | USE OF SEMI-ALLOGENEIC CELL LINE-PEPTIDE COMPLEXES FOR THE TREATMENT OF CANCER, AIDS AND OTHER VIRAL DISEASES | GATTONI-CELLI S;SHEARER G;GRENE E;NEWTON D;BROWN E;BERZOFSKY J;DEGROOT A; | MEDICAL UNIVERSITY OF SOUTH CAROLINA; | The present invention provides a composition comprising a semi-allogeneic hybrid fusion cell and an immunogenic peptide. In particular, isolated peptides of HIV (Human Immunodeficiency Virus), HTLV-1, Hepatitis B virus, Hepatitis C virus, rubeola virus, influenza A virus and Human Papilloma Virus are provided in the compositions of the present invention. Moreover, isolated cancer-specific peptides specific to a cancer, for example, B cell lymphoma, T cell lymphoma, myeloma, leukemia, breast cancer, pancreatic cancer, colon cancer, lung cancer, renal cancer, liver cancer, prostate cancer, melanoma and cervical cancer are provided in the compositions of the present invention. Moreover, the present invention provides a method of treating a subject infected by one or more of HIV, HTLV-1, Hepatitis B virus, Hepatitis C virus, rubeola virus, influenza A virus and Human Papilloma Virus, comprising administering a composition comprising an effective amount of a hybrid fusion cell and an effective amount of an isolated immunogenic peptide of the virus in a pharmaceutically acceptable carrier. Further, the present invention provides a method of treating cancer in a subject with one or more of B cell lymphoma, T cell lymphoma, myeloma, leukemia, breast cancer, pancreatic cancer, colon cancer, lung cancer, renal cancer, liver cancer, prostate cancer, melanoma and cervical cancer, comprising administering a composition comprising an effective amount of a hybrid fusion cell and an effective amount of an isolated immunogenic peptide of the cancer in a pharmaceutically acceptable carrier | 2000 Apr 24 | 2000 Dec 21 |
| WO01058461 | MYCOBACTERIUM AG85 COMPLEX-SPECIFIC T CELL PEPTIDES AND USE IN DIAGNOSTIC AND THERAPEUTIC APPLICATIONS THEREOF | DOCKRELL H;SMITH S;BROOKES R; | GLAXO GROUP LIMITED; | Use of (a) a polypeptide which comprises an epitope sequence of the formula (I): X1 L/I/M X2 X3 X4 X5 X6 X7 V/L/I wherein X1 is G, X2 is P, X3 is V, X4 is E, X5 is Y, X6 is L and X7 is Q, or X1 is K or R, X2 is I or V, X3 is A, X4 is N, X5 is N, X6 is T and X7 is R, or an epitope sequence which is an analogue of (I) and which can be recognised by a CD8 T cell that recognises (I); or (b) an expression vector comprising a polynucleotide encoding a said polypeptide (a) operably linked to a regulatory sequence capable of providing for expression of the said polypeptide (a); for use in the manufacture of a medicament for vaccinating prophylactically or therapeutically against infection by a mycobacterium by stimulating a CD8 T cell response. Also provided are polypeptides, expression vectors and cells which can be used to treat mycobacterial infections; and a method of detecting T cells that can recognise the epitope defined above | 2001 Feb 12 | 2001 Aug 16 |
| WO02061435 | SUBUNIT VACCINES WITH A2 SUPERMOTIFS | SIDNEY J;SETTE A;GREY H;SOUTHWOOD S; | EPIMMUNE INC.; | Methods to design vaccines which are effective in individuals bearing A2 supertype alleles are described. Single amino acid substitution analogs of known A2-supertype binding peptides, and large peptide libraries were utilized to rigorously define the peptide binding specificities of A2-supertype molecules. While each molecule was noted to have unique preferences, large overlaps in specificity were found. The presence of the hydrophobic and aliphatic residues L, I, V, M, A, T, and Q in positon 2 of peptide ligands was commonly tolerated by A2-supertype molecules. L, I, V, M, A, and T were tolerated at the C-terminus. While examination of secondary influences on peptide binding revealed allele specific preferences, shared features could also be identified, and were utilized to define an A2-supermotif. Shared features also correlate with cross-reactivity; over 70% of the peptides that bound A*0201 with high affinity were found to bind at least 2 other A2-supertype molecules. Finally, the coefficients for use in the development of algorithms for the prediction of peptide binding to A2- supertype molecules are provided | 2002 Jan 29 | 2002 Aug 8 |
| WO02083714 | METHOD AND SYSTEM FOR OPTIMIZING MULTI-EPITOPE NUCLEIC ACID CONSTRUCTS AND PEPTIDES ENCODED THEREBY | SETTE A;CHESNUT R;LIVINGSTON B;BAKER D;NEWMAN M;BROWN D; | EPIMMUNE INC.; | The invention relates to the field of biology. In particular, the invention relates to a method and system for designing optimized multi-epitope vaccines having selected combinations of spacer nucleic acid at the junctions of the multi-epitope constructs encoding a plurality of CTL and/or HTL eoutioe oeotudes so as to minimize the number of junciontal epitopes and provide vaccines with increased immunogenicity | 2002 Mar 28 | 2002 Oct 24 |
| WO02094313 | VACCINE COMPOSITION | FULLER D;FULLER J;HAYNES J;SHIPLEY T; | POWDERJECT VACCINES I;POWDERJECT RESEARCH LIMITED; | Recombinant nucleic acid molecules are described. The molecules have a first nucleic acid sequence encoding an antigen containing two or more cytolytic T lymphocyte (CTL) epitopes, wherein said epitopes are selected from the amino acid sequences of SEQ ID NOs: 1, 2, 3, 4, 5 and 6 and analogues of any thereof which can be recognised by a CD8+ T cell that recognises an epitope with the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5 or 6. Peptides encoded by the molecules and vectors and compositions containing these molecules are also described. Methods of eliciting an immune response using these molecules are also described | 2002 May 20 | 2002 Nov 28 |
| WO04022084 | A METHOD OF MODULATING CELLULAR ACTIVITY AND MOLECULES FOR USE THEREIN | AGUILAR MI;PERLMUTTER P;PURCELL A;WEBB A;ROSSJOHN J; | MONASH UNIVERSITY;THE UNIVERSITY OF MELBOURNE; | The present invention relates generally to a method of modulating T cell functional activity by utilising beta-amino acid substituted peptides and to agents useful for the same. More particularly, the present invention relates to a method of modulating class I restricted T cell activity by utilising beta-amino acid substituted peptides and to agents useful for the same. The method of the present invention is useful, inter alia, in the treatment and/or prophylaxis of conditions characterised by suboptimal T cell stimulation such as that which occurs in some viral infections and in anti-tumour immunity, as well as aberrant, unwanted or otherwise inappropriate T cell functioning such as, but not limited to, graft rejection or autoimmune conditions, the present invention is further directed to methods of identifying, designing and/or modifying agents capable of modulating T cell functional activity | 2003 Sep 4 | 2004 Mar 18 |
| WO04031210 | OPTIMIZED MULTI-EPITOPE CONSTRUCTS AND USES THEREOF | SETTE A;CHESNUT R;NEWMAN MJ;LIVINGSTON BD;BABE LM;CHEN Y;DEYOUNG LM;HUANG MTF;POWER SD; | EPIMMUNE INC.;GENENCOR INTERNATIONAL I; | The invention relates to the field of biology. In particular, it relates to multi-epitope nucleic acid and peptide vaccines and methods of designing such vaccines to provide increased immunogenicity | 2003 Oct 3 | 2004 Apr 15 |
| WO03077836 | COMPOSITIONS AND METHODS FOR THE DETECTION, DIAGNOSIS AND THERAPY OF HEMATOLOGICAL MALIGNANCIES | GAIGER A;ALGATE P;MANNION J;RETTER M; | CORIXA CORPORATION; | Disclosed are methods and compositions for the detection, diagnosis, prognosis, and therapy of hematological malignancies, and in particular, B cell leukemias, lymphomas and multiple myelomas. Disclosed are compositions, methods and kits for eliciting immune and T cell responses to specific malignancy-related antigenic polypeptides and antigenic polypeptide fragments thereof in an animal. Also disclosed are compositions and methods for use in the identification of cells and biological samples containing one or more hematological malignancy-related compositions, and methods for the detection and diagnosis of such diseases and affected cell types. Also disclosed are diagnostic and therapeutic kits, as well as methods for the diagnosis, therapy and/or prevention of a variety of leukemias and lymphomas | 2002 Nov 6 | 2003 Sep 25 |
| WO04072263 | NUCLEIC ACID AND CORRESPONDING PROTEIN NAMED 158P1D7 USEFUL IN THE TREATMENT AND DETECTION OF BLADDER AND OTHER CANCERS | JAKOBOVITS A;MORRISON R;RAITANO A;CHALLITA-EID P;PEREZ-VILLAR J;MORRISON K;FARIS M;GE W;GUDAS J;KANNER S; | AGENSYS I; | A novel gene (designated 158P1D7) and its encoded protein are described. While 158P1D7 exhibits tissue specific expression in normal adult tissue, it is aberrantly expressed in multiple cancers including set forth in Table 1. Consequently, 158P1D7 provides a diagnostic and/or therapeutic target for cancers. The 158P1D7 gene or fragment thereof, or its encoded protein or a fragment thereof, can be used to elicit an immune response | 2004 Feb 10 | 2004 Aug 26 |
| WO04075636 | METHODS FOR USING COMPOSITIONS COMPRISING HEAT SHOCK PROTEINS OR ALPHA-2-MACROGLOBULIN IN THE TREATMENT OF CANCER AND INFECTIOUS DISEASE | SRIVASTAVA P; | UNIVERSITY OF CONNECTICUT HEALTH CENTER; | The present invention relates to methods and compositions for the prevention and treatment of infectious diseases, and cancers. The methods of the invention comprises administering (a) a composition comprising a population of complexes of antigenic proteins or antigenic peptides derived from antigenic cells or viral particles and one or more different heat shock proteins; and (b) a non-heat shock protein and non-alpha-2-macroglobulin-based treatment modality. The population or the protein preparation used to produce the antigenic peptides comprises at least 50% of the different proteins or at least 50 different proteins of the antigenic cells or viral particles. Methods for making antigenic peptides comprise digesting a protein preparation of antigenic cells, a cellular fraction thereof, or of viral particles with one or more proteases, or exposing the protein preparation to ATP, guanidium hydrochloride, and/or acidic conditions | 2003 Mar 5 | 2004 Sep 10 |
| WO04075723 | METHODS FOR THE EARLY DIAGNOSIS OF OVARIAN CANCER | O'BRIEN T;CANNON M;SANTIN A; | THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ARKANSAS; | The present invention discloses the protease stratum corneum chymotrytic enzyme (SCCE) is specifically over-expressed in ovarian and other malignancies. A number of SCCE peptides can induce immune responses to SCCE, thereby demonstrating the potential of these peptides in monitoring and the development of immunotherapies for ovarian and other malignancies | 2004 Feb 20 | 2004 Sep 10 |
| WO04078098 | PEPTIDES ASSOCIATED WITH HLA-DR MHC CLASS II MOLECULES INVOLVED IN AUTOIMMUNE DISEASES | HILL J;CAIRNS E;BELL D; | LONDON HEALTH SCIENCES CENTRE RESEARCH INC.; | Antigenic peptides that bind to MHC Class II molecules with the shared epitope referred to as HLA-DR molecules are disclosed. More specifically, are citrullinated antigenic peptides having an increased affinity for HLA-DR molecules and associated with Rheumatoid arthritis. These novel peptides provide the basis for new methods of diagnosis and treatment of Rheumatoid arthritis | 2004 Mar 5 | 2004 Sep 16 |
| WO04078099 | COMPOSITIONS AND METHODS FOR THE GENERATION OF PROTECTIVE IMMUNE RESPONSE AGAINST MALARIA | PLUSCHKE G;M?LER M;ROBINSON J;ZURBRIGGEN R;FREUND-RENARD A; | PEVION BIOTECH LTD.;SWISS TROPICAL INSTITUTE;UNIVERSITAT ZRI; | The invention presents vaccine formulations comprising highly antigenic epitopes identified within the semiconserved loop-I of domain III that are capable of eliciting parasite growth inhibitory antibodies. The cyclized or linear peptides can be applied by known adjuvants or be encapsulated by or attached onto the surface of liposomes or virosomes (IRIVs) which serve as human compatible antigen delivery systems. Both cyclized and linear versions of the peptide antigens are surprisingly effective in eliciting immune responses that are cross-reactive with parasite-expressed AMA-1 | 2004 Mar 3 | 2004 Sep 16 |
| WO04078776 | NY-ESO-1 PEPTIDES WHICH BIND TO CLASS II MOLECULES AND USES THEREOF | PFREUNDSCHUH M;NEUMANN F;RAMMENSEE HG;STEVANOVIC S; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | The invention relates to peptides which consist of amino acid sequences found in the NY-ESO-1 molecule, which bind to MHC-Class II molecules. These can be used alone, or in combination with other peptides | 2004 Mar 1 | 2004 Sep 16 |
| WO04078957 | DENDRITIC CELL PRESENTING ALPHA-GLYCOSYLCERAMIDE DERIVATIVE AND ANTIGEN AND USABLE IN SUPPRESSING IMMUNE RESPONSE | SERIZAWA I;YAMAGUCHI Y;EHARA H; | KIRIN BEER KABUSHIKI KAIS; | A dendritic cell and a cell mixture capable of suppressing an antigen-specific T cell-dependent immune response. The above-described dendritic cell, which can suppress an antigen-specific T cell-dependent immune response, presents an antigen fragment of the above antigen presented against the T cell in the immune reaction and an alpha-glycosylceramide derivative. The above-described cell mixture, which can suppress an antigen-specific T cell-dependent immune response, contains a dendritic cell at least presenting an antigen fragment of the above antigen presented against the T cell in the immune reaction and another dendritic cell at least presenting an alpha-glycosylceramide derivative | 2004 Mar 3 | 2004 Sep 16 |
| WO04078960 | AMYLASES PRODUCING AN ALTERED IMMUNOGENIC RESPONSE AND METHODS OF MAKING AND USING THE SAME | HARDING F; | GENENCOR INTERNATIONAL I; | The present invention provides novel amylase variants that exhibit reduced immunogenic responses, as compared to the parental proteins. The present invention further provides DNA molecules that encode novel amylase variants, host cells comprising DNA encoding novel amylase variants, as well as methods for making amylases less allergenic. In addition, the present invention provides various compositions that comprise these amylase variants that are less immunogenic than the wild-type amylases | 2003 Feb 26 | 2004 Sep 16 |
| WO04080375 | VACCINE | MEYKENS R;METTENS P;MONTEYNE P; | GLAXOSMITHKLINE BIOLOGICALS SA; | The present invention relates to novel vaccine therapies, and prophylactic treatments of atherosclerotic diseases. Accordingly there is provided, immunogens comprising specific fragments or derivatives of Apolipoprotein C-III (ApoCIII). The vaccines of the present invention, comprising said immunogens, are potent in the prevention, or reduction, of atherosclerotic plaque formation over prolonged periods of time, thereby reducing the potential of atherosclerosis leading to coronary or cerebrovascular disease. Also provided are methods of treating or preventing atherosclerosis by active vaccination, or passive vaccination through administration to a patient of an antibody that is capable of binding to the specific fragments of ApoCIII. Specific monoclonal antibodies and their use in therapy of atherosclerosis is provided. There is further provided the use of the immunogens of the present invention in medicine, and methods of their production. The fragments of ApoCIII which form the basis of the immunogens of the present invention, and also the targets for passive immunotherapy, are encompassed within the regions between amino acid numbers 45-76 and, particularly, 12-35 of the mature form of human ApoCIII | 2004 Mar 11 | 2004 Sep 23 |
| WO04080403 | INFLUENZA VIRUS VACCINE | GARSKY V;IONESCU R;LIANG X;PRZYSIECKI C;SHI L;SHIVER J;BIANCHI E;INGALLINELLA P;PESSI A; | CO.INC.;ISTITUTO DI RICERCHE DI BIOLOGIA MOLECOLARE; | The present invention provides vaccines against disease caused by infection with influenza virus, and methods of vaccination. The vaccines comprise peptides derived from the M2 and/or HA proteins of influenza virus conjugated to a carrier protein | 2004 Mar 5 | 2004 Sep 23 |
| WO04080419 | HUMANIZED ANTIBODIES THAT RECOGNIZE BETA AMYLOID PEPTIDE | BASI G;SALDANHA J;YEDNOCK T; | NEURALAB LIMITED;WYETH; | The invention provides improved agents and methods for treatment of diseases associated with amyloid deposits of Abeta in the brain of a patient. Preferred agents include humanized antibodies | 2004 Mar 12 | 2004 Sep 23 |
| WO04081029 | NOVEL NON-INVASIVE MARKER FOR LIVER DISEASE | LEDERKREMER GZ;KONDRATYEV M; | RAMOT AT TEL AVIV UNIVERSITY LTD.; | A monoclonal antibody or fragment thereof, capable of specifically binding to at least one epitope of sH2a and/or being elicited by at least one epitope, and assays, kits, and methods of use thereof | 2004 Mar 14 | 2004 Sep 23 |
| WO04081051 | BISPECIFIC ANTIBODIES | YOUNG S; | THE UNIVERSITY OF BIRMINGHAM; | The present invention discloses a bispecific antibody (BAb) comprising two antibodies, each of which has a binding specificity to a different epitope situated on the surface of a target structure. Each of said antibodies has a relatively low binding affinity for its respective epitope. The BAbs produced according to the present invention have much lower affinity for cross-reactive non-target tissue due to the lower affinity of the MAbs used to produce them. These BAbs still provide high avidity for target tissue due to the cumulative nature of the binding interactions | 2004 Mar 11 | 2004 Sep 23 |
| WO04082710 | TREATMENT OF ALLERGIC DISEASES USING A MODULATOR OF THE NOTCH SIGNALING PATHWAY | BODMER M;BRIEND E;CHAMPION B;LENNARD A;MCKENZIE G;RAGNO S;TUGAL T;WARD G;YOUNG L; | LORANTIS LIMITED; | A method for reducing an immune response to an allergen or antigenic determinant thereof in a mammal by administering a modulator of the Notch signalling pathway | 2004 Mar 22 | 2004 Sep 30 |
| WO04083250 | CONSTRUCT COMPRISING RECOGNITION DOMAIN OF ANTIBODY AGAINST VON WILLEBRAND FACTOR-SPECIFIC CLEAVING ENZYME | SOEJIMA K;NAKAGAKI T;MATSUMOTO M;FUJIMURA Y; | JURIDICAL FOUNDATION THE CHEMO-SERO-THERAPEUTIC RESEARCH INSTITUTE; | It is intended to provide an epitope recognized by an antibody (hereinafter referred to as anti-ADAMTS-13 antibody in some cases) against an enzyme (hereinafter referred to as ADAMTS-13 in some cases) specifically cleaving von Willebrand factor (hereinafter referred to as vWF in some cases), and a polypeptide containing this epitope domain. A polypeptide located at from the 449- to 687-positions in the amino acid sequences constituting ADAMTS-13 which is recognized by the anti-ADAMTS-13 antibody or a peptide fragment originating in this polypeptide | 2004 Mar 17 | 2004 Sep 30 |
| WO04085635 | MELAN-A PEPTIDE ANALOGUE-VIRUS-LIKE-PARTICLE CONJUGATES | BACHMANN M;MANOLOVA V;MEIJERINK E;PROBA K;SCHWARZ K; | CYTOS BIOTECHNOLOGY AG; | The present invention is related to the fields of molecular biology, virology, immunology and medicine. The invention provides a modified virus-like particle (VLP) comprising a VLP which can be loaded with immunostimulatory substances, in particular with DNA oligonucleotides containing non-methylated C and G (CpGs), and particular peptides derived from MelanA linked thereto. Such CpG-VLPs are dramatically more immunogenic than their CpG-free counterparts and induce enhanced B and T cell responses. The immune response against MelanA peptide analogues optionally coupled, fused or attached otherwise to the VLPs is similarly enhanced as the immune response against the VLP itself. In addition, the T cell responses against the MelanA peptide analogues are especially directed to the Thl type. Antigens attached to CpG-loaded VLPs may therefore be ideal vaccines for prophylactic or therapeutic vaccination against allergies, tumors and other self-molecules and chronic viral diseases | 2004 Mar 25 | 2004 Oct 7 |
| WO04087041 | AN ANTIBODY FRAGMENT CAPABLE OF MODULATING MULTIDRUG RESISTANCE AND COMPOSITIONS AND KITS AND METHODS USING SAME | REITER Y;HAUS-COHEN M; | DEVELOPMENT FOUNDATION LTD.; | An antibody fragment and methods of utilizing same are provided. The antibody fragment includes an antigen binding region capable of binding an extracellular portion of a P-glycoprotein thereby at least partially inhibiting drug efflux activity in multidrug resistant cells | 2004 Jan 8 | 2004 Oct 14 |
| WO04087747 | NOVEL CITRULLINATED SYNTHETIC PEPTIDES AND USES THEREOF | MIGLIORINI P; | UNIVERSITA' DP; | Novel citrullinated linear synthetic peptides and multiple antigen peptides (MAP) comprising them, which are useful as antigens in assays for the detection of antibodies and T cells specific to citrullinated antigens, are described, the antibodies and T cells being characteristic of auto-immune diseases such as rheumatoid arthritis and multiple sclerosis | 2004 Mar 29 | 2004 Oct 14 |
| WO04089980 | THERAPEUTIC CANCER VACCINE | STRATEN P;ANDERSEN M; | KREFTENS BEK; | The present invention relates to polypeptide fragments capable of raising a specific T-cell response, wherein said fragment comprises a peptide consisting of at least 9 consecutive amino acid residues of ML-IAP as well as to said fragments for use as medicaments. The invention furthermore relates to use of said polypeptide frag-ments in the manufacture of a medicament for treatment of a clinical condition, such as cancer. The invention also relates to methods of selecting a peptide comprising a fragment of ML-IAP for use in a vaccine composition as well as to vaccine composi-tions comprising isolated ML-IAP (SEQ ID NO:1) and/or one or more fragments thereof | 2004 Apr 7 | 2004 Oct 21 |
| WO04092207 | RESPIRATORY SYNCYTIAL VIRUS (RSV) PEPTIDES | LASTERS I;DESMET J;STEGMANN T; | ALGONOMICS NV; | The present invention relates to peptides which are suitable for inducing an immune response to RSV and to the use of said peptides for the preparations of vaccines, compositions and in methods of diagnosis | 2004 Apr 16 | 2004 Oct 28 |
| WO04092209 | S. PNEUMONIAE ANTIGENS | MEINKE A;NAGY E;HANNER M;DEWASTHALY S;STIERSCHNEIDER U; | INTERCELL AG; | The present invention discloses isolated nucleic acid molecules encoding a hyperimmune serum reactive antigen or a fragment thereof as well as hyperimmune serum reactive antigens or fragments thereof from S. pneumoniae, methods for isolating such antigens and specific uses thereof | 2004 Apr 15 | 2004 Oct 28 |
| WO04092741 | MAPPING DISCONTINUOUS ANTIBODY OR APTAMER EPITOPES FOR PROTEIN STRUCTURE DETERMINATION AND OTHER APPLICATIONS | DRATZ E;MUMEY B;JESAITIS A; | MONTANA STATE UNIVERSITY; | The present invention is directed to methods of mapping antibody or aptamer epitopes for use in a variety of utilities including the elucidation of the tertiary structure of proteins. A method of the invention, antibody imprinting, uses antibodies or aptamers against target proteins and random peptide probe libraries to map the epitopes of antibody binding sites on target proteins | 2004 Apr 14 | 2004 Oct 28 |
| WO04094454 | HLA-A2 TUMOR ASSOCIATED ANTIGEN PEPTIDES AND COMPOSITIONS | FIKES J;ISHIOKA G;SETTE A;CHESNUT R; | EPIMMUNE INC.; | A peptide or composition comprising at least one HLA-A2 epitope or analog from CEA, HER2/neu, MAGE2, MAGE3, or p53 | 2004 Apr 16 | 2004 Nov 4 |
| WO04094458 | MAJOR HISTOCOMPATIBILITY COMPLEX (MHC)-PEPTIDE ARRAYS | STERN L;STONE J;CARVEN G;CHITTA S;STRUG I;COCHRANE J; | UNIVERSITY OF MASSACHUSETTS;MASSACHUSETTS INSTITUTE OF TECHNOLGY; | This invention relates to arrays of immobilized major histocompatibility complex (MHC)-peptide complexes and methods for using them | 2004 Apr 15 | 2004 Nov 4 |
| WO04094596 | NOVEL IMMUNOGENIC COMPOSITIONS FOR THE PREVENTION AND TREATMENT OF MENINGOCOCCAL DISEASE | ZLOTNICK G;FLETCHER L;FARLEY J;BERNFIELD L;ZAGURSKY R;METCALF B; | WYETH HOLDINGS CORPORATION; | The present invention relates to Neisseria ORF2086 proteins, crossreactive immunogenic proteins which can be isolated from nesserial strains or prepared recombinantly, including immunogenic portions thereof, biological equivalents thereof, antibodies that immunospecifically bind to the foregoing and nucleic acid sequences encoding each of the foregoing, as well as the use of same in immunogenic compositions that are effective against infection by Neisseria meningitidis serogroup B | 2004 Apr 16 | 2004 Nov 4 |
| WO04096238 | NUCLEIC ACID COMPOSITIONS AND METHODS FOR USE | KNIGHT D; | CENTOCOR I;GOLETZ T;MCCARTHY S;SCALLON B;SNYDER L;BRANIGAN P; | Polynucleotide compositions encoding a tumor antigen antigenic determinant and optionally including a nucleic acid adjuvant are disclosed. The compositions are useful for prophylaxis or treatment of cancer | 2003 Apr 1 | 2004 Nov 11 |
| WO04098497 | CD4+ HUMAN PAPILLOMAVIRUS (HPV) EPITOPES | BABE L;DE YOUNG L;HARDING F;HUANG M;POWER S;STICKLER M; | GENENCOR INTERNATIONAL I; | The present invention provides CD4+ T-cell epitopes in E6, E7 and E2 proteins from various strains of human papillomavirus (HPV). In some preferred embodiments, the present invention provides means for the development of HPV vaccines, in particular multivalent vaccines for the prevention of infection with high-risk HPV strains. In additional embodiments, the present invention provides means for the development of therapeutic vaccines against high-risk HPV types that prevent the development of benign and/or malignant tumors in infected individuals. The present invention further provides epitopes suitable for use in prophylactic and therapeutic vaccines | 2004 Apr 23 | 2004 Nov 18 |
| WO04098515 | NUCLEIC ACIDS AND CORRESPONDING PROTEINS ENTITLED 109P1D4 USEFUL IN TREATMENT AND DETECTION OF CANCER | RAITANO A;CHALLITA-EID P;GE W;PEREZ-VILLAR J;KANNER S;JAKOBOVITS A; | AGENSYS I; | A novel gene 109P1D4 and its encoded protein, and variants thereof, are described wherein 109P1D4 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table i. Consequently, 109P1D4 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 109P1D4 gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 109P1D4 can be used in active or passive immunization | 2004 Apr 30 | 2004 Nov 18 |
| WO04101750 | IL-23p40 SPECIFIC IMMUNOGLOBULIN DERIVED PROTEINS, COMPOSITIONS, METHODS AND USES | BENSON J;CUNNINGHAM M; | CENTOCOR I; | Novel anti-IL-23p40 specific human Ig derived proteins, including, without limitation, antibodies, fusion proteins, and mimetibodies, isolated nucleic acids that encode the anti-IL-23p40 Ig derived proteins, vectors, host cells, transgenic animals or plants, and methods of making and using thereof, are useful for therapeutic compositions, methods and devices. Preferably, the anti-IL-23p40 specific human Ig derived proteins do not bind the p40 subunit of IL-12 and, thus, do not neutralize IL-12-related activity | 2004 May 6 | 2004 Nov 25 |
| WO04104173 | Ovr115 ANTIBODY COMPOSITION AND METHODS OF USE | PILKINGTON G;KELLER GA;LI W;CORRAL L;SIMON I; | DIADEXUS I; | The invention provides isolated anti-ovarian, pancreatic, lung or breast cancer antigen (Ovr115) antibodies that bind to Ovr115 on a mammalian cell in vivo. The invention also encompasses compositions comprising an anti-Ovr115 antibody and a carrier. These compositions can be provided in an article of manufacture or a kit. Another aspect of the invention is an isolated nucleic acid encoding an anti-Ovr115 antibody, as well as an expression vector comprising the isolated nucleic acid. Also provided are cells that produce the anti-Ovr115 antibodies. The invention encompasses a method of producing the anti-Ovr115 antibodies. Other aspects of the invention are a method of killing an Ovrl 15-expressing cancer cell, comprising contacting the cancer cell with an anti?Ovr115 antibody and a method of alleviating or treating an Ovrl 15-expressing cancer in a mammal, comprising administering a therapeutically effective amount of the anti-Ovr115 antibody to the mammal | 2004 May 17 | 2004 Dec 2 |
| WO04042004 | MOUSE MODEL FOR AUTOIMMUNE DISORDERS | CATON A; | THE WISTAR INSTITUTE OF ANATOMY AND BIOLOGY; | A non-human mammalian model of an autoimmune disorder co-expresses a major histocompatibility (MHC) class II-restricted T cell receptor (TCR) and a selected peptide that binds to the TCR. The selected peptide is selectively expressed by MHC class II positive antigen presenting cells (APC) of the mammal. Models with high penetrance of disease are those in which the selected peptide is a MHC class II-restricted T cell determinant that specifically binds with high affinity to the TCR. Models with low penetrance of disease are those in which the selected peptide binds with low affinity to the TCR. These models, which may be transgenic mammals, are used in method for identifying diagnostic and therapeutic markers and targets characteristic of an autoimmune disorder | 2003 Oct 27 | 2004 May 21 |
| WO04043988 | PTPRK IMMUNOGENIC PEPTIDE | CASTELLI C;PARMIANI G; | ISTITUTO NAZIONALE PER LO STUDIO E LA CURA DEI TUMORI; | An immunogenic peptide isolated from PTPRK protein represents a novel HLA II restricted epitope recognized by CD4+T cells and is used in cancer immunotherapy or diagnosis | 2003 Nov 12 | 2004 May 27 |
| WO04043994 | A RETRO-INVERSO GONADOTROPIN-RELEASING HORMONE PEPTIDE AND VACCINE COMPOSITION | MILLAR ROBE; | SHIMODA BIOT;MILLAR R; | The invention describes a retro-inverso (RI) gonadotropin-releasing hormone (GnRH) peptide which is capable of eliciting an immune response directed against GnRH, the peptide having the amino acid sequence GPRLGYSWHX, wherein the amino acids are D-amino acids and X is any amino acid. More particularly, X is E, Q, P or G, and even more particularly, X is E or Q. Thus, a preferred amino acid sequence for the peptide is GPRLGYSWHE. The peptide may optionally include one or more additional D-amino acids at its N- or C-terminus, for example a cysteine residue or a series of linker amino acids, such as a plurality of glycine amino acid residues. Thus, a second preferred amino acid sequence for the peptide is GPRLGYSWHEC, which includes a cysteine residue at the C-terminus for conjugation purposes. The invention also describes a vaccine composition for use in controlling fertility, heat, contraception and/or treating sex hormone-related diseases, and a method for controlling and or treating fertility and sex hormone-related diseases | 2003 Nov 7 | 2004 May 27 |
| WO04044005 | KIT FOR ASSAYING HUMAN LOW-MOLECULAR WEIGHT CD14 AND ANTIBODY | FURUSAKO S;SHIRAKAWA K; | MOCHIDA PHARMACEUTICAL CO. L; | It is intended to provide an antibody constructed by using, as an antigen, a peptide comprising from 8 to 30 amino acid residues selected from among the amino acid residues at the 1- to 68-positions in the amino acid sequence of human high-molecular weight CD14; or an antibody binding to a peptide comprising a specific amino acid sequence in the 1- to 68-positions as described above. Using an assay kit for assaying human low-molecular weight CD14 (preferably a sandwich method) with the use of the above antibody, human low-molecular weight CD14 can be highly sensitively, conveniently and specifically assayed qualitatively or quantitatively, which is useful in diagnosing patients with sepsis | 2003 Nov 12 | 2004 May 27 |
| WO04044167 | EXPRESSION, PURIFICATION AND USES OF A PLASMODIUM FALCIPARUM LIVER STAGE ANTIGEN 1 POLYPEPTIDE | LANAR D;HILLIER C;LYON J;ANGOV E;KUMAR S;ROGERS W;BARBOSA A; | WALTER REED ARMY INSTITUTE OF RESEARCH; | In this application is described the expression and purification of a recombinant Plasmodium falciparum (3D7) LSA-NRC polypeptide. The method of the present invention produces a highly purified polypeptide which is useful as a vaccine and as a diagnostic reagent | 2003 Nov 12 | 2004 May 27 |
| WO04045550 | IMMUNIZATION WITH PORPHYROMONAS GINGIVALIS PROTECTS AGAINST HEART DISEASE | GENCO C;GIBSON F;GENCO C;GIBSON F; | Boston Medical Center Corporation;BOSTON MEDICAL CENTER CORPORATION; | The invention is directed to a method of preventing and treating a patient having a risk factor and/or a symptom of cardiovascular disease using an immunogenic composition comprising an immunogenically effective portion of Porphyromonas gingivalis in a pharmaceutically effective carrier substance, and a vaccine for same | 2003 Nov 18 | 2004 Jun 3 |
| WO04045555 | IMMUNOGENIC EPITOPES FOR FIBROBLAST GROWTH FACTOR 5 (FGF-5) PRESENTED BY HLA-A3 AND HLA-A2 | HANADA KI;YANG J;PERRY-LALLEY D; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA as represented by THE SECRETARY OF THE DEPARTMENT OF HEALTH AND HUMAN SERVICES; | The present disclosure relates to peptides for use in immunotherapy of tumors. The peptides disclosed herein are derived from the amino acid sequence of a renal cell carcinoma-associated antigen, fibroblast growth factor-5 (FGF-5). In one example, the peptide is an HLA-A3 epitope (such as NTYASPRFK). In another example, the peptide is an HLA-A2 epitope (such as MLSVLEIFAV). Methods are provided for using such peptides, and variants or fusions thereof, to stimulate an immune response in a subject. The peptides disclosed herein can be formulated into pharmaceutical composition for administration to a subject | 2003 Nov 19 | 2004 Jun 3 |
| WO04046727 | POLYCLONAL-POLYCLONAL ELISA ASSAY FOR DETECTING N-TERMINUS-PROBNP | JACKOWSKI G;DAVEY M;STANTON E;KUPCHAK P; | SYN XP; | A specific and sensitive in vitro ELISA assay and diagnostic test kit is disclosed for determining levels of NT-proBNP protein in a variety of bodily fluids, non-limiting examples of which are blood, serum, plasma, urine and the like. The NT-proBNP ELISA assay test employs the sandwich ELISA technique to measure circulating NT-proBNP in human plasma. In order to obtain antibodies with specific binding properties for targeted amino acid sequences within human proBNP, recombinant human proBNP (or rhproBNP) was expressed and purified for use as an immunogen. Polyclonal antibodies (PAb) to specific amino acid sequences were subsequently purified from goat serum by sequential affinity purification. Recombinant human NT-proBNP (or rhNT-proBNP) was expressed and purified in order to obtain material for use in calibration of a quantitative method for measurement of human NT-proBNP | 2003 Nov 17 | 2004 Jun 3 |
| WO04052392 | CANCER IMMUNOTHERAPY | YOUNG L;ADAMS D;IRVINE A; | THE UNIVERSITY OF BIRMINGHAM; | The invention relates to the use of polycomb group proteins as a tumour-associated antigens. Polycomb group proteins are highly involved in body architecture development, haematopoiesis and cell cycle control. Aberrant expression of polycomb proteins has been linked with haematological malignancies, mainly lymphomas. This invention relates to the use of these polycomb group proteins as antigens for cancer immunotherapy. Immunological responses can be raised against these proteins and such responses are active against polycomb protein over-expressing tumour cells | 2003 Dec 10 | 2004 Jun 24 |
| WO04052917 | HLA-A1, A2 -A3,-A24,-B7,AND -B44 TUMOR ASSOCIATED ANTIGEN PEPTIDES AND COMPOSITIONS | KEOGH E;SOUTHWOOD S;FIKES J;SETTE A; | EPIMMUNE INC.; | A peptide or composition comprising at least one epitope or analog from CEA, HER2/neu, MAGE2, MAGE3, or p53 | 2003 Dec 10 | 2004 Jun 24 |
| WO04052930 | TARGETING SINGLE EPITOPES | MOURITSEN Sr; | PHARMEXA A; | The invention relates to novel immunogenic agents that are capable of inducing specific B-cell immunity directed against one single epitope present in a self-antigen. The immunogenic agent is a chimeric binding protein that binds specifically to a first receptor, said first receptor being one that binds a second receptor present in an antigen of an animal, wherein said chimeric binding protein comprises: (a) a B-cell epitope in the form of a binding site that specifically binds the first receptor and which competes with the second receptor for binding to the first receptor, (b) a scaffold protein structure being autologous in said mammal, and (c) at least one tolerance breaking amino acid sequence, which is heterologous in said animal and which binds to an MHC Class II molecule in said animal. In preferred embodiments, the chimeric binding protein is in the form of an anti-idiotypic antibody having a tolerance-breaking aminoacid sequence introduced. The invention further relates to methods of preparing the immunogens and methods of using the immunogens in therapy. Also, the invention relates to proteins, nucleic acid fragments, recombinantly modified host cells and virus that are useful in the practice of the methods of the invention | 2003 Dec 11 | 2004 Jun 24 |
| WO04055183 | CARCINOEMBRYONIC ANTIGEN-SPECIFIC IMMUNODOMINANT EPITOPE RECOGNIZED BY CD4+T CELLS AND USES THEREOF | PROTTI MP;DELLABONA P;PROTTI M;DELLABONA P; | FONDAZIONE CENTRO SAN ROMANELLO DEL MONTE TABOR;FONDAZIONE CENTRO SAN RAFFAELE DEL MONTE TABOR; | CEA epitopes are specifically recognized by CD4+T cells and are useful also in helping the induction of CD8+ response and amplification of memory effect | 2003 Dec 1 | 2004 Jul 1 |
| WO04056862 | IMMUNOGENIC COMPOSITIONS TO THE CCK-B/GASTRIN RECEPTOR AND METHODS FOR THE TREATMENT OF TUMORS | MICHAELI D;CAPLIN M;WATSON S;GRIMES S; | APHTON CORPORATION; | The invention concerns immunogens, immunogenic compositions and method for the treatment of gastrin-dependent tumors. The immunogens comprise a gastrin receptor immunomimic peptide conjugated to an immunogenic carrier. The immunogens are capable of inducing antibodies in vivo which bind to the gastrin-receptor (GR) in gastrin responsive malignant or premalignant tumor, thereby preventing growth stimulating peptide hormones from binding to the receptors, and inhibiting tumor cell growth. The invention also comprises specific antibodies against the gastrin-receptor for passive immunization. Furthermore, the invention comprises cytotoxic molecule derivatized anti-GR antibodies. The invention also concerns diagnostic methods for detecting gastrin-dependent tumors in vivo or from a tissue biopsy using the antibodies of the invention. Active and passive immunization can be combined providing an immune response against GR, G17 and/or G17-Gly | 2003 Dec 17 | 2004 Jul 8 |
| WO04058822 | RETARGETING | WINTER G;TOMLINSON I;IGNATOVICH O; | DOMANTIS LIMITED; | The present invention relates to a method for the generation of immunoglobulin molecules of predetermined specificity. In particular, the invention relates to a method for the retargeting of the epitope binding specificity of one or more antibodies using single variable domains which exhibit a dominant epitope binding specificity | 2003 Dec 24 | 2004 Jul 15 |
| WO04060145 | ISOLATION AND IDENTIFICATION OF CROSS-REACTIVE T CELLS | ZHANG J; | BAYLOR COLLEGE OF MEDICINE; | Cross-reactive T cells recognizing both MBP93-105 and HHV-61-13 peptides represent a significant subset of T cells with some degree of TCR degeneracy. It appears that the recognition of the cross-reactive T cells has a less stringent requirement for the flanking residues of the two peptides. In contrast, these flanking residues are critical for the T cell recognition of mono-specific T cells. The association between HHV-6 and autoreactive immune responses to MBP indicates that cross-reactive T cells, peptides from the V-D-J region of the T cell receptor from autoreactive T cells, and antiviral agents may prevent or treat MS | 2003 Dec 23 | 2004 Jul 22 |
| WO04060262 | MEDICAL TREATMENT | BODMER M;BRIEND E;CHAMPION B;LENNARD A;MCKENZIE G;TUGAL T;WARD G;YOUNG L; | LORANTIS LIMITED; | A product comprises i) a pharmaceutically acceptable support matrix suitable for in vivo administration bearing a multiplicity of modulators of Notch signalling; and ii) an antigen or antigenic determinant, or a polynucleotide coding for an antigen or antigenic determinant; as a combined preparation for simultaneous, contemporaneous, separate or sequential use for modulation of the immune system | 2004 Jan 7 | 2004 Jul 22 |
| WO04060320 | METHODS OF IMPROVING HEALTH-RELATED QUALITY OF LIFE IN INDIVIDUALS WITH SYSTEMIC LUPUS ERYTHEMATOSUS | STRAND V;LINNIK M;JOH T; | LA JOLLA PHARMACEUTICAL COMPANY; | The invention provides methods for stabilizing or improving the health-related quality of life in individuals with SLE, and methods of selecting individuals suitable for such treatment. One method of stabilizing or improving the health-related quality of life of an individual with SLE involves the administration of an effective amount of dsDNA epitope, such as in the form of an epitope-presenting carrier or an epitope-presenting valency platform molecule like UP 394, to the individual. The invention further provides a method of stabilizing or improving the health-related quality of life of an individual with SLE involving the reduction of the level of SLE-associated antibodies in the individual, optionally through administration of a dsDNA epitope to the individual. In addition, methods of screening patients are provided. Kits useful in the methods of the invention are also provided | 2003 Dec 29 | 2004 Jul 22 |
| WO04062462 | MONCLONAL ANITBODIES TO RNA BINDING PROTEIN GW182 | FRITZLER MARV; | UNIVERSITY TECHNOLOGIES INTERNATIONAL I;FRITZLER M; | The present invention includes antibodies to human GW182 protein and the use of those antibodies in clinical and diagnostic assays | 2004 Jan 16 | 2004 Jul 29 |
| WO04062583 | VACCINE AND METHOD FOR PREVENTING BIOFILM FORMATION | APICELLA MICH; | UNIVERSITY OF IOWA RESEARCH FOUNDATION;APICELLA M; | The present invention is directed to compounds and methods for immunizing a patient against a biofilm-producing bacterial infection and a vaccine related thereto | 2004 Jan 7 | 2004 Jul 29 |
| WO04062584 | THERAPEUTIC AND PROPHYLACTIC VACCINE FOR THE TREATMENT AND PREVENTION OF PAPILLOMAVIRUS INFECTION | GARCEA R; | REGENTS OF THE UNIVERSITY OF COLORADO; | This invention provides compositions including a chimera of papillomavirus capsid polypeptide L2 and poloypeptide including an immunotherapeutic epitope, and GST fusions thereof. The present invention also provides complexes comprising chimeras of papillomavirus L2 polypeptides non-covalently assocaited with papillomavirus L1 polypeptides, and GST fusions thereof. These compositions may be used to elicit immune responses in apatient to papillomavirus. Therapeutic and prophylactic vaccines for the prevention and treatment of viral infection, especially papillomavirus infectiona nd cervical cancers and warts associated therewith, made from compositions of this invention, are also disclosed. Nucleic acids and expression vectors coding for compositions of this invention are also disclosed | 2004 Jan 6 | 2004 Jul 29 |
| WO04063217 | DIMERIZED PEPTIDE | TAKASU H;SAMIZO F; | SUGIYAMA H;CHUGAI SEIYAKU KABUSHIKI KAIS;SUMITOMO PHARMACEUTICALS COMPANY L; | It is intended to provide a novel cancer antigen peptide and a cancer vaccine comprising this cancer antigen peptide. A peptide dimer wherein two peptide monomers capable of forming a cancer antigen peptide containing at least one cysteine residue and consisting of from 7 to 30 amino acid residues are bonded to each other via a disulfide bond | 2004 Jan 15 | 2004 Jul 29 |
| WO04064784 | COMPOSITION AND METHOD FOR PREVENTING OR TREATING A VIRUS INFECTION | GERHARD W;OTVOS L; | THE WISTAR INSTITUTE; | The present invention provides multiple antigenic agents compositions and the use thereof to prevent or treat viral infections | 2004 Jan 14 | 2004 Aug 5 |
| WO04065409 | PEPTIDE MIMOTOPES OF LIPOOLIGOSACCHARIDE FROM NONTYPEABLE HAEMOPHILUS INFLUENZAE AS VACCINES | GU XX; | GOVERNMENT OF THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY DOHAS; | The present invention relates to peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccines | 2004 Jan 21 | 2004 Aug 5 |
| WO04065936 | IMMUNOGLOBULIN E DETECTION IN MAMMALIAN SPECIES | HAMMERBERG B; | NORTH CAROLINA STATE UNIVERSITY; | The present invention provides antibodies (e.g., monoclonal antibodies) that specifically binds to mammalian IgE (e.g., dog IgE). In some embodiments the antibodies bind to an epitope between amino acids 145-166 of mammalian IgE; in other embodiments the antibodies bind to an epitope between amino acids 356-374 of mammalian IgE. The antibodies may be used for allergen reactivity testing in human subjects or animal subjects for veterinary purposes | 2004 Jan 15 | 2004 Aug 5 |
| WO04067023 | SURVIVIN-DERIVED PEPTIDES AND USE THEREOF | STRATEN E;ANDERSEN M; | SURVAC A; | MHC Class I-restricted peptides derived from the tumor associated antigen, survivin, which peptides are capable of binding to Class I HLA molecules at a high affinity, capable of eliciting INF-gamma-producing cells in a PBL population of a cancer patient and capable of in situ detection of cytotoxic T cells in a tumor tissue, therapeutic and diagnostic composition comprising the peptide and uses thereof | 2004 Jan 30 | 2004 Aug 12 |
| WO04067032 | IDENTIFICATION OF GENE SEQUENCES AND PROTEINS INVOLVED IN VACCINIA VIRUS DOMINANT T CELL EPITOPES | TERAJIMA M;CRUZ J;ENNIS F; | UNIVERSITY OF MASSACHUSETTS MEDICAL CENTER; | The present invention relates to the identification of gene sequences and proteins involved in vaccinia virus dominant T cell epitopes. Two vaccinia virus CD8+ T cell epitopes restricted by the most common human MHC class I allele, HLA-A0201 have been identified. Both epitopes are highly conserved in vaccinia and variola viruses. The induction of the T cell responses following primary vaccination is demonstrated by the kinetics of epitope specific CD8+ T cells in 3 HLA-A0201 individuals. This information will be useful for the design and analyses of the immunogenicity of experimental vaccinia vaccines, and for basic studies of human T cell memory | 2004 Jan 26 | 2004 Aug 12 |
| WO04067559 | COMPOUNDS USEFUL IN THE DIAGNOSIS AND TREATMENT OF PREGNANCY-ASSOCIATED MALARIA | THEANDER T;SALANTI A;HVIID L;STAALS?T;JENSEN A;LAVSTSEN T;DAHLBACK M; | K?ENHAVNS UNIVERSITET; | The present invention relates to nucleic acid molecules related to the var2csa gene family as well as amino acid sequences encoded by such nucleic acid molecules with respect to their role in mediating adhesion of infected red blood cells to chondroitin sulphate A (CSA) in the placenta which is characteristic for the pathogenesis of pregnancy associated malaria (PAM). Accordingly, The invention provides the use compounds that are related to VAR2CSA polypeptides and var2csa nucleic acid molecules as medicaments, as well as it provides pharmaceutical compositions, in particular immunological compositions and vaccines, hereunder nucleotide-based vaccines comprising these compounds. In addition, the invention provides the use of the compounds mentionedfor the manufacture of compositions, such as immunogenic compositions. Other aspects of the invention relates to methods of treatment and prevention of pregnancy associated malaria wherein these methods are based on the nucleic acid molecules and polypeptides of the invention. As these compounds can also be used as biotechnological tools the invention provides in vitro diagnostic methods and kits comprising reagents and IgGs/antibodies designated to the use in such methods. The invention also relates to methods of identifying agents capable of modulating the VAR2CSA dependent adhesion to CSA and agent capable of interacting with VAR2CSA. Finally, a method for identifying polypeptides, which will induce a specific IgG/antibody response upon administration to a subject is provided by the invention | 2003 Dec 30 | 2004 Aug 12 |
| WO04068135 | IDENTIFICATION AND MODIFICATION OF IMMUNODOMINANT EPITOPES IN POLYPEPTIDES | KOREN EUGE;LOWE JOHN; | GENENTECH I;KOREN E;LOWE J; | The invention provides for methods of modifying immunodominant epitopes on polypeptides, preferably polypeptides intended for therapeutic use. Knowledge of immunodominant epitopes prior to clinical use of polypeptides would be useful to design and engineer less immunogenic molecules. The invention provides for methods of identifying immonodominant epitopes and modifying an immunodominant epitope to reduce the immune response to the polypeptide while still retaining a substantial therapeutic activity of the polypeptide. The modified polypeptides are useful therapeutically | 2001 Jun 1 | 2004 Aug 12 |
| WO04071422 | STREPTOCOCCAL SERUM OPACITY FACTORS AND FIBRONECTIN-BINDING PROTEINS AND PEPTIDES THEREOF FOR THE TREATMENT AND DETECTION OF STREPTOCOCCAL INFECTION | COURTNEY H; | UNIVERSITY OF TENNESSEE RESEARCH FOUNDATION; | Provided herein are S. pyogenes serum opacity factor (SOF)- and S. dysgalactiae fibronectin-binding protein-based polypeptide, polynucleotide, and antibody compositions and methods. Compositions provided herein are effective in eliciting opsonic and/or protective antibodies specific for S. pyogenes and/or S. dysgalactiae and, consequently, are useful inter alia for the treatment, diagnosis, and monitoring of streptococcal infections, including S. pyogenes and S. dysgalactiae infections, and diseases associated with S. pyogenes and S. dysgalactiae infections ranging from, but not limited to, mild and generally self-limiting infections of the pharynx and skin to more severe and life-threatening infections, such as toxic shock syndrome and necrotizing fasciitis. Compositions and methods provided herein will also find use in preventing, or minimizing the severity of, the major sequelae of streptococcal infections are acute rheumatic fever and acute glomerulonephritis, as well as associated autoimmune neurological disorders | 2004 Feb 5 | 2004 Aug 26 |
| WO05021582 | METHODS FOR THE EARLY DIAGNOSIS OF OVARIAN CANCER | O'BRIEN T;CANNON M;BEARD J;SANTIN A;SHIGEMASA K; | THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ARKANSAS; | Protease hepsin is specifically over-expressed in ovarian and other malignancies. A number of hepsin peptides can induce immune responses to hepsin, thereby demonstrating the potential of these peptides in monitoring and the development of immunotherapies for ovarian and other malignancies. There is also provided a hepsin protein variant that is useful as a marker for ovarian cancer cells, prostate cancer cells or kidney cancer cells | 2004 Aug 30 | 2005 Mar 10 |
| WO0194948 | ELISA FOR BACULOVIRUS | HISSEY P; | GLAXO GROUP LIMITED; | The present invention provides a method of determining the presence, absence or titre of baculovirus particles in a sample, the method comprising detecting the binding of a primary antibody which recognises an epitope present in a baculovirus particle to the baculovirus particle, if present in the sample, thereby determining the presence, absence or titre of baculovirus particles in a sample | 2001 May 31 | 2001 Dec 13 |
| WO04022709 | EPITOPE SEQUENCES | SIMARD J;DIAMOND D;LIU L;LIU Z; | MANNKIND CORPORATION; | Disclosed herein are polypeptides, including epitopes, clusters, and antigens. Also disclosed are compositions that include said polypeptides and methods for their use | 2003 Sep 5 | 2004 Mar 18 |
| WO04023091 | LOCALIZATION OF HUMAN CYTOMEGALOVIRUS NUCLEIC ACIDS AND PROTEINS IN HUMAN CANCER CELLS | COBBS C;HARKINS L; | THE UAB RESEARCH FOUNDATION; | The present disclosure shows human cytomegalovirus (HCMV) is strongly associated with a variety of cancers in humans. In addition, the present disclosure shows a specific strain of HCMV, HDu, is associated with several types of cancer. The identification cells harboring certain strains of HCMV, such as HDu, will provide a novel mechanism to identify cells that are at risk for undergoing oncogenesis. Novel strategies for detecting HCMV are also disclosed | 2003 Sep 3 | 2004 Mar 18 |
| WO04024770 | POLYCLONAL ANTIBODIES, PREPARATION METHOD THEREOF AND USE OF SAME | SARASA BARRIO M; | UNIVERSIDAD DZ; | The invention relates to polyclonal antibodies which specifically recognise, and have a strong affinity with, the two most significant amyloid peptides, Ab40 and Ab42. The invention also relates to the use thereof in assessing drugs which activate the degradation of amyloid peptides characteristic of Alzheimer's disease as well as drugs which inhibit the formation of same | 2003 Aug 13 | 2004 Mar 25 |
| WO04024773 | METHODS FOR REGULATING CANCER | STEPHENSON SA; | THE QUEEN ELIZABETH HOSP; | The present invention provides methods for inhibiting cancerous growth of a cell using an antibody or an antigen-binding portion thereof which binds to an epitope of EphB4 polypeptide. Purified antibodies of EphB4 are also provided. The invention also provides methods for preventing or treating cancer. The invention also relates to methods of identifying agents that can inhibit cancerous growth of a cell | 2003 Sep 16 | 2004 Mar 25 |
| WO04026265 | METHODS FOR VACCINE IDENTIFICATION AND COMPOSITIONS FOR VACCINATION COMPRISING NUCLEIC ACID AND/OR POLYPEPTIDE SEQUENCES OF THE HERPESVIRUS FAMILY | SYKES K;HALE K;JOHNSTON S; | MACROGENICS I;BOARD OF REGENTS TUOTS; | The instant invention relates to antigens and nucleic acids encoding such antigens obtainable by screening a herpesvirus genome, in particular an HSV-1 genome. In more specific aspects, the invention relates to methods of isolating such antigens and nucleic acids and to methods of using such isolated antigens for producing immune responses. The ability of an antigen to produce an immune response may be employed in vaccination or antibody preparation technique | 2003 Sep 23 | 2004 Apr 1 |
| WO04026897 | WT1 SUBSTITUTION PEPTIDES | GOTOH M;TAKASU H;SAMIZO F;KUSUNOSE N;NAKATSUKA M; | CHUGAI SEIYAKU KABUSHIKI KAIS;SUMITOMO PHARMACEUTICALS COMPANY L;SUGIYAMA H; | It is intended to provide novel WT1 substitution peptides in which a cysteine residue is substituted by a specific amino acid residue, polynucleotides encoding these peptides, cancer vaccines with the use of the above peptides or polynucleotides either in vivo or in vitro, etc. Namely, a peptide containing the amino acid sequence represented by the following general formula and having a CTL-inducing activity: X-Y-Thr-Trp-Asn-Gln-Met-Asn-Leu (SEQ ID NO:4) wherein X represents Ser, Ala, Abu, Arg, Lys, Orn, Cit, Leu, Phe or Asn; and Y represents Tyr or Met; a polynucleotide encoding this polypeptide; and a cancer vaccine, etc. containing the peptide or polynucleotide as the active ingredient | 2003 Sep 19 | 2004 Apr 1 |
| WO04026900 | VACCINE | JONES G; | YABA LIMITED; | Immunogenic peptides derived from Chlamydia trachomatis are provided. Their use in vaccines is described as are the vaccines themselves and methods of vaccinating subjects using such vaccines | 2002 Sep 17 | 2004 Apr 1 |
| WO04029071 | MAGE-C2 ANTIGENIC PEPTIDES AND USES THEREOF | MA W;GERMEAU C;VAN DEN EYNDE B;COULIE P;FALLEUR T; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | This invention relates to isolated peptides derived from MAGE-C2, nucleic acid molecules that encode MAGE-C2 and the isolated peptides derived from MAGE-C2, expression vectors comprising the nucleic acid molecules, host cells transformed or transfected with the nucleic acid molecules or the expression vectors, and to tetramers comprising the peptides, HLA molecules, bata-2 microglobulin and a first and second biding partner. This invention also relates to methods for using the peptides, nucleic acid molecules, expression vectors, tetramers and complexes of this invention as well as to cytolytic T cells which recognize the peptides in complex with an HLA molecule | 2003 Sep 26 | 2004 Apr 8 |
| WO04029248 | TUMOR ANTIGEN PROTEIN AND UTILIZATION THEREOF | TSUKAHARA T;NABETA Y;KAWAGUCHI S;IKEDA H;WADA T;YAMASHITA T; | SUMITOMO PHARMACEUTICALS CO. L;SATO N; | It is intended to provide a CTL inducer containing as the active ingredient a protein having an amino acid sequence which is the same or substantially the same as the amino acid sequence represented by SEQ ID NO:2, a tumor antigen peptide originating in the above protein, etc | 2003 Sep 19 | 2004 Apr 8 |
| WO04029274 | METHOD FOR GENERATING AN IMMUNE RESPONSE AND REAGENTS THEREFOR | GNAJTIC S;OLD L; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | Isolated peptides are disclosed which, when processed, generate a coordinated immune response | 2003 Sep 26 | 2004 Apr 8 |
| WO04029628 | DETECTION OF CORRECTLY FOLDED HLA CLASS 1 COMPLEXES BY ELISA | BOWNESS P; | THE EDWARD JENNER INSTITUTE FOR VACCINE RESEARCH; | The invention relates to an assay for peptide binding to HLA class I molecules based on the use of enzyme-linked immunoabsorbent assay (ELISA) | 2003 Sep 26 | 2004 Apr 8 |
| WO04031229 | POLYPEPTIDE | LU X;KUWABARA P;SELWOOD D; | LUDWIG INSTITUTE FOR CANCER RESEARCH;GENOME RESEARCH LIMITED;UCL Cruciform Limited; | The invention relates to a polypeptide, or part thereof, which inhibits the apoptotic activity of the tumour suppressor protein p53 and including screening methods to identify agents which interfere with the activity of said polypeptide | 2003 Oct 3 | 2004 Apr 15 |
| WO04031230 | NOVEL MHC II ASSOCIATED PEPTIDES | KROPSHOFER H;ROEHN T;VOGT A; | ROCHE AG FH; | The present invention provides novel naturally-processed antigenic peptides which are candidate tumor antigens in melanoma and other tumors. These antigenic peptides are presented by human MHC class II HLA-DR molecules. They originate from the translation factor eIF-4A, the IFN-gamma-inducible protein p78, the cytoskeletal protein vimentin and the iron-binding surface protein melanotransferrin. The antigenic peptides of the present invention can be used as markers in diagnosis of the respective tumors and in therapy as anti-tumor vaccines | 2003 Sep 24 | 2004 Apr 15 |
| WO04031380 | METHOD OF STRENGTHENING FOREIGN EPITOPE PRESENTATION BY MHC CLASS I BY INHIBITING TAP ACTIVITY | IWAMOTO A;TACHIKAWA A; | DNAVEC RESEARCH INC.; | A method of strengthening the presentation of a foreign epitope by MHC class I by inhibiting TAP activity. A mammalian cell-infecting viral vector encoding both of a TAP inhibitor and epitope-binding beta 2m is constructed and transferred into mammalian cells. Thus, endogenous MHC class I/peptide complexes are decreased by the TAP inhibitor and MHC class I/peptide complexes containing epitope-binding beta 2m expressed from the vector are successfully presented on the cell surface at a high frequency. This method is useful in the vaccine therapy for infection and cancer | 2003 Oct 1 | 2004 Apr 15 |
| WO04032868 | METHODS OF TREATING ALZHEIMER'S DISEASE USING ANTIBODIES DIRECTED AGAINST AMYLOID BETA PEPTIDE AND COMPOSITIONS THEREOF | ROSENTHAL A;LEVKOWITZ G; | RINAT NEUROSCIENCE CORP.; | Monoclonal antibodies directed against amyloid beta peptide and methods of using same for treatment and prevention of Alzheimer's disease and Down's syndrome are described | 2003 Oct 9 | 2004 Apr 22 |
| WO04032957 | IMMUNIZATION OF NON-HUMAN MAMMALS AGAINST STREPTOCOCCUS EQUI | GUSS BENG;FLOCK JI;JACOBSSON KARI;JANZON KENN;FRYKBERG LARS;FLOCK MARG;BERGMAN RUNE; | GUSS B;FLOCK JI;JACOBSSON K;JANZON K;FRYKBERG L;FLOCK M;BERGMAN R; | The present invention is concerned with an antigenic composition comprising at least one antigen that comprises at least one antigenic epitope or antigenic determinant derived from a protein present in one or both of S. equi subsp. Equi and subsp. Zooepidemicus and use thereof for immunization of non-human mammals against S. equi subsp. equi and/or subsp. Zooepidemicus. The present invention also discloses a vaccine composition comprising the aforesaid antigenic composition as immunizing component. The antigens used are EAG, FNZ, SFS, SEC and ScLC | 2003 Oct 10 | 2004 Apr 22 |
| WO04032960 | PHARMACEUTICAL COMPOSITIONS DIRECTED TO ERB-B1 RECEPTORS | KREYSCH HG;SCHMIDT Jr; | MERCK PATENT GMBH; | The invention relates to pharmaceutical compositions comprising different molecules, preferably monoclonal antibodies, each comprising epitopes that bind simultaneously to different sites within the same ErbB 1 receptor domain. The preferred antibodies according to this invention are MAb 425 and MAb 225 each in its murine, chimeric and humanized version. The invention relates to the use and methods for an improved treatment of preferably tumors by means of said compositions | 2003 Oct 9 | 2004 Apr 22 |
| WO04032961 | BISPECIFIC ANTI-ERB-B ANTIBODIES AND THEIR USE IN TUMOR THERAPY | KREYSCH HG; | MERCK PATENT GMBH; | The invention relates to novel bispecific antibodies and their use in tumor therapy. The novel antibodies have the ability to bind to ErbB receptors, preferably ErbB1 receptors, which are overexpressed on many cancer tissues. Since the different specificities of the antigen-binding sites are directed to different epitopes within the binding domain of same or different ErbB receptors, these antibodies are more effective with respect to inhibition and down-regulation of the ErbB receptor and the corresponding signaling cascade | 2003 Oct 9 | 2004 Apr 22 |
| WO04033483 | LIPOSOMAL SYSTEM AND METHOD OF USING SAME | TURK M;GUEVARA J;HOUGHTON A; | SLOAN-KETTERING INSTITUTE FOR CANCER RESEARCH; | Liposomal systems formed from a peptide having a ubiquitinatable region and an antigenic region, a pH-sensitive liposomal carrier; and a bilayer-associated adjuvant, such as MPL are useful as vaccine compositions. These compositions are surprisingly effective in inducing an in vivo immune response to the antigen corresponding to the antigenic region | 2003 Oct 6 | 2004 Apr 22 |
| WO04034031 | A METHOD FOR DIAGNOSIS AND PROGNOSIS OF MULTIPLE SCLEROSIS | GENAIN C;VON BUDINGEN HC;MENGE T;HAUSER S; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA; | This invention provides methods utilizing detection/quantification of autoantibodies to specific epitopes of myelin components (e.g. to conformational epitope of myelin/oligodendrocyte glycoprotein (MOG)) for the definite diagnosis, and/or staging or typing, and/or prognosis of multiple sclerosis | 2003 Oct 10 | 2004 Apr 22 |
| WO04034033 | METHODS AND SYSTEMS FOR DETECTING MHC CLASS I AND CLASS II BINDING PEPTIDES | MONTERO-JULIAN F;MONSEAUX S; | BECKMAN COULTER I; | The invention is based on the discovery that MHC class I and class II monomers immobilized to a solid surface are still capable of forming complexes with suitable MHC-binding peptides. Methods for detecting peptide binding to HLA monomers, and methods for measuring the relative degree of binding between two MHC-binding peptides as well as a method of measuring the rate of dissociation of peptides from MHC complexes are provided. The present invention also provides systems and kits useful for conducting the methods of the invention | 2003 Oct 10 | 2004 Apr 22 |
| WO04034974 | ANTI-REG I GAMMA ANTIBODY FOR TREATMENT OF COLON CANCER | LASEK A; | INCYTE CORPORATION; | The invention provides a antibody that specifically binds human REG I gamma 7; protein and is used to diagnose or treat a colon cancer | 2003 Oct 7 | 2004 Apr 29 |
| WO04035609 | USE OF POLY-ALPHA2,8-SIALIC ACID MIMETIC PEPTIDES TO MODULATE NCAM FUNCTIONS. | ROUGON G;TORREGROSSA P;SCHACHNER M;SCHAFER NIELSEN C; | CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE;UNIVERSITE DE LA MEDITERRANEE AIX MARSEILLE II;SCHAFER N;UNIVERSITAET HAMB; | The invention relates to the use of a peptide consisting of 5 to 30 amino acid residues, preferably 9 to 15, most preferably about 12 amino acid residues, said peptide comprising a B epitope of a poly-alpha 2,8 sialic acid attached to NCAM, which is recognized by an anti-poly-alpha 2,8 sialic acid (PSA) antibody, for the preparation of a medicament for modulating NCAM functions, to be administered for the prevention and/or the treatment of neurodegenerative diseases, brain and spine lesions, age-related learning and memory problems, and cancer | 2003 Oct 16 | 2004 Apr 29 |
| WO04035742 | SETS OF DIGITAL ANTIBODIES DIRECTED AGAINST SHORT EPITOPES, AND METHODS USING SAME | WANG J;HU W; | ABMETRIX I; | The present invention relates generally to sets of digital antibodies directed against short epitopes, and use thereof in methods for protein analysis | 2003 Oct 15 | 2004 Apr 29 |
| WO04036222 | ANTIBODIES REACTIVE WITH BETA (1-3) -GLUCANS | KONDORI N; | MATTSBY-BALTZER I; | Monoclonal antibodies reactive with beta (1-3) -glucans are disclosed. More precisely, two monoclonal antibodies, B3B and A10A, reactive with beta (1-3) -glucan and/or beta (1-3) (1-6) -glucan associated epitopes in free, non-associated form, and/or in cell wall fragments of Candida andCryptococcus is disclosed. Further, A10A is also reactive with a beta (1-6) (1-3) -glucan epitope present on the intact cell surface of C. albicans, C. parapsilosis, C. krusei, C. glabrata and/or C. neoformans. Said antibodies can be used for the detection of free, cellwall associated, and/or cell surface associated beta (1-3) glucans utilizing immunoassays or immunohistology for the laboratory diagnosis of fungal infections. They may be used also for detection of airborn mould, or mould present in dust, water, or in any other component | 2003 Oct 21 | 2004 Apr 29 |
| WO04037175 | COMPOSITIONS AND METHODS FOR TREATING HUMAN PAPILLOMAVIRUS-MEDIATED DISEASE | BEACH K;HEDLEY M;URBAN R; | ZYCOS INC.; | The invention includes methods of treating an HPV-mediated disease by administration to an individual of a pharmaceutical composition comprising a nucleic acid that encodes a polypeptide comprising an epitope of a naturally occurring HPV protein. The methods include the selection of individuals for treatment with the composition according to the age of the recipient, as well as the use of the composition to elicit a cross-reactive anti-HPV immune response | 2003 Oct 16 | 2004 May 6 |
| WO04039401 | USE OF ANTIBODIES TO THE GAMMA 2 CHAIN OF LALLMININ 5 TO INHIBIT TUMOR GROWTH AND METASTASIS | SALO SIRP;TRYGGVASON KARL; | SALO S;TRYGGVASON K; | The present invention provides a methods and compositions for inhibiting tumor growth and/or metastasis involving the administering to a subject with a laminin 5-secreting tumor of an amount effective to inhibit tumor growth and/or metastasis of an antibody that binds to one or more epitopes of the laminin 5 gamma 2 chain | 2003 Oct 29 | 2004 May 13 |
| WO04041849 | EPSTEIN BARR VIRUS PEPTIDE EPITOPES, POLYEPITOPES AND DELIVERY SYSTEM THEREFOR | KHANNA R;DURAISWAMY J;KHANNA R;DURAISWAMY J; | THE COUNCIL OF THE QUEENSLAND INSTITUTE OF MEDICAL RESEARCH;THE COUNCIL OF THE QUEENSLAND INSTITUTE OF MEDICAL RESEARCH; | Immunogenic cytotoxic T cell epitope peptides of Epstein Barr Virus LMP1 protein are provided having between nine and seventeen amino acids and minimal consensus sequences selected from QRH, AGNDG, QNW, VLYS and DSNSNE. These peptides, either individually or in polyepitope constructs, are useful in pharmaceutical compositions, vaccines and methods of treating Epstein Barr Virus associated diseases such as Hodgkin's Disease and/or Nasopharyngeal Carcinoma, although without limitation thereto. A preferred mode of polyepitope delivery is an adenovirus-based system | 2003 Nov 3 | 2004 May 21 |
| WO04043141 | NOVEL INHIBIN-RELATED MULTIPLE ANTIGENIC PEPTIDE COMPOSITIONS THAT ENHANCE PRODUCTION PERFORMANCE IN AVIANS | CADD G;SATTERLEE D;FIORETTI W; | AGRITECH TECHNOLOGY L;THE BOARD OF SUPERVISORS OF LOUISIANA STATE UNIVERSITY AND AGRICULTURAL AND MECHANICAL COLLEGE; | The present invention provides novel compositions of matter comprising MAP compositions comprising at least 2 inhibin-related peptides linked to a backbone. These compositions are immunogenic and enhance production performance when administered together with an acceptable carrier to animals, especially avians | 2003 Nov 7 | 2004 May 27 |
| WO03105665 | EPSTEIN-BARR VIRUS-SPECIFIC IMMUNIZATION | CELIS E; | MAYO FOUNDATION FOR MEDICAL EDUCATION AND RESEARCH; | The invention provides materials and methods for using EBV EBNA2 peptide epitopes to treat and/or prevent post-transplant lymphoproliferative disorders (PTLD). The invention also provides compositions and articles of manufacture containing EBNA2 peptide epitopes that can be used to treat and/or prevent PTLD | 2003 Jun 13 | 2003 Dec 24 |
| WO03106682 | HLA-A24-RESTRICTED CANCER ANTIGEN PEPTIDE | GOTOH M;TAKASU H; | CHUGAI SEIYAKU KABUSHIKI KAIS;SUMITOMO PHARMACEUTICALS COMPANY L;SUGIYAMA H; | It is intended to provide an HLA-A24-restricted peptide originating in WT1 which has an activity of inducing CTL in vivo; a polynucleotide encoding this peptide; a cancer vaccine using the above peptide or polypeptide in vivo or in vitro; etc. The above cancer vaccine is usable in treating a large number of patients suffering from cancer | 2003 Jun 12 | 2003 Dec 24 |
| WO04000238 | UTILIZATION OF MHC CLASS II BINDING MOTIFS IN IMMUNIZATION TO PRODUCE IMMUNE SERUM, MONOCLONAL ANTIBODIES AND VACCINES | WEGMANN K; | TITTLE T; | This invention provides compositions and methods for raising humoral antibody responses. The compositions are peptides containing major histocompatibility Class 11 antigen binding motifs (ABM) either native or inserted into the peptide sequence. The ABM can be at the carboxy or amino terminus of the peptide and is shown to provide a T cell epitope thereby assuring adequate T cell help. Associated with the ABM is an extended peptide that rests outside the Class 11 molecule and that is recognized by the B cell, a B cell epitope. This B cell epitope can be a contiguous peptide sequence either at the amino or carboxy terminus. The extended peptide can be irrelevant and can serve as a bridge to an attached B cell epitope such as a hapten. These haptens can be any chemical structure such as a fluorescein molecule or a carbohydrate. The compositions and methods of this invention provide inexpensive vaccines to raise antibodies | 2003 Mar 21 | 2003 Dec 31 |
| WO04003221 | METHODS FOR PEPTIDE-PROTEIN BINDING PREDICTION | HOFFMAN S;ISTRAIL S;FLOREA L;HALLDORSSON B;KOHLBACHER O;SCHWARTZ R; | APPLIED BIOS; | The present teachings are related to methods for predicting the binding affinity of peptides for proteins. Individual methods for creating predictions and methods for combining predictions are also related. Some embodiments of the present teachings include methods for manufacturing a vaccine and a computer system for implementing the methods of the present teachings | 2003 Jun 27 | 2004 Jan 8 |
| WO04004642 | TCELL TOLERANCE AND MODULATION OF AUTOIMMUNITY BY CD8 ALPHA CD4+ DENDRITIC CELLS | ZAGHOUANI H; | THE UNIVERSITY OF TENNESSEE RESEARCH CORPORATION; | The present invitation relates to compositions and methods for treatment of autoimmune disorders such as multiple sclerosis. More specifically, the present invention teaches the in vivo use of a subset of dendritic cells in conjunction with engineered immunoglobins containing a self-peptide which together have modulatory effects on tolerization of autoreactive T cells and sustain peripheral tolerance against self-antigens | 2003 Jul 2 | 2004 Jan 15 |
| WO04005469 | PEPTIDES FROM THE E2, E6 AND E7 PROTEINS OF HUMAN PAPILLOMAVIRUSES 16 AND 18 FOR DETECTING AND/OR DIAGNOSING CERVICAL AND OTHER CANCERS | HU Y;ROSENFELD M; | IMPACT DIAGNOSTICS I; | An isolated protein sequence or peptide from the E2, E6 or E7 early coding region of human papillomavirus (HPV) that is soluble in an aqueous medium, and characterized by a relative paucity of tryptophan, methionine and cysteine residues, and a relative abundance of glycine and asparagine residues. Also disclosed are isolated protein sequences or peptides from the E2, E6 or E7 early coding regions of HPV 16 and 18 and methodologies for detecting or diagnosing cancer or cellular abnormalities. Detection and/or diagnosis of cancer or cellular abnormalities may include detecting and/or diagnosing pre-cancerous or pre-malignant conditions, cervical dysplasia, cervical carcinoma, koilocytosis, hyperkeratosis, intraepithelial lesions, and other cancers. Preferably, novel methodologies for detecting and/or diagnosing cancer or cellular abnormalities of the present invention may comprise the steps of (1) reacting a sample of body fluid or tissue with isolated protein sequences or peptides; (2) forming an antibody-peptide complex; and (3) detecting the antibody-peptide complex | 2003 Jul 2 | 2004 Jan 15 |
| WO04006861 | PEPTIDES AND METHODS OF SCREENING IMMUNOGENIC PEPTIDE VACCINES AGAINST ALZHEIMER'S DISEASE | CHAIN D;FITZER-ATTAS C; | MINDSET BIOPHARMACEUTICALS I; | The invention is in the field of immunogenicity. In one embodiment, the invention relates to method of identifying T-cell epitopes in amyloid beta peptide or homologue thereof. In another embodiment, the invention relates to a vaccine comprising an amyloid beta peptide or homologue thereof, whereby the selected peptide is a peptide which lacks certain T-cell epitopes or a peptide which is modified by deleting or modifying amino acids so as to reduce ox eliminate the T-cell epitopes. The selected peptides are further assessed for reduced capacity to form fibrils, reduced cytotoxicity, and a reduced ability to induce a cellular autoimmune response. The selected peptides are further assessed for ability to induce a humoral immune response. In another embodiment, the invention relates to a method of predicting the reaction of an individual to a vaccine, which comprises amyloid beta peptide or homologue thereof, based on the HLA haplotype of the subject. In another embodiment, the invention provides a method for matching a vaccine comprising arnyloid beta peptide or homologue thereof to an individual, based on the HI,A haplotype of that individual. In another embodiment, the invention provides a vaccine comprising an amyloid beta peptide or homologue thereof, whereby the arnyloid beta peptide or homologue thereof, lacks the ability to induce a T-cell response | 2003 Jul 16 | 2004 Jan 22 |
| WO04006952 | THERAPEUTIC TB VACCINE | ANDERSEN P;ROSENKRANDS I;STRYHN A; | STATENS S; | The present invention is based on a number of M.tuberculosis derived proteins and protein fragments which are induced during the latent stage of infection characterized by low oxygen tension in the microenvironment of the infecting TB-bacteria. The invention is directed to the use of these polypeptides, immunologically active fragments thereof and the genes encoding them for immunological compositions such as therapeutic vaccines and diagnostic reagents | 2003 Jul 8 | 2004 Jan 22 |
| WO04007555 | DETECTION OF PRION DISEASE | VAN OERS JWAM;HACK C;ROEM-HAAGSMA DDI;LANGEVELD J;GARSSEN G;JACOBS J;VAN ENGELENBURG FAC; | PEPSCAN SYSTEM BV;STICHTING SANQUIN BLOE; | This invention relates to the field of the detection of prion deseases. The invention provides a binding molecule or antibody specifically reactive with an epitope which is exposed on a part of an aberrant conformer (PrPsc) of a prion protein after treatment of said conformer with a protease wherein said epitope is not or only partly exposed on a prion protein which has not been treated with a protease | 2003 Jul 17 | 2004 Jan 22 |
| WO04009109 | METHODS FOR DETECTING DEANTIGENIZED T CELL EPITOPES AND USES THEREOF | BANERJEE S; | CO.KG; | The present invention encompasses a novel approach to develop modified proteins that induce a reduced (or no) immune response (compared to an unmodified protein) in an animal, wherein one or more T cell epitope sequences present in the unmodified protein is/are replaced with one or more 'deantigenized' T cell epitope sequences, which exhibit reduced or no binding to a MHC molecule (compared to the T cell epitope); thereby hindering the cellular process of immune response. The present invention provides a novel method for detecting deantigenized T cell epitopes and further reducing or eliminating immunogenicity of an otherwise immunogenic protein by substituting one or more deantigenized T cell epitope sequences for one or more T cell epitope sequences of the parent immunogenic polypeptide | 2003 Jul 23 | 2004 Jan 29 |
| WO04011483 | ISOLATED, SSX-2 AND SSX-2 RELATED PEPTIDES USEFUL AS HLA BINDERS AND CTL EPITOPES, AND USES THEREOF | VALMORI D;AYYOUB M;PINILLA C; | LUDWIG INSTITUTE FOR CANCER RESEARCH;TORREY PINES INSTITUTE FOR MOLECULAR STUDIES; | The invention related to peptides which bind to HLA molecules and are reactive with T cells that also react with complexes of HLA-A2 molecules and the peptide of SEQ ID NO: 17. Various uses of the peptides are disclosed | 2003 Jul 23 | 2004 Feb 5 |
| WO04011947 | MULTIPLE HYBRID IMMUNOASSAY | CAMPBELL J;FRANK P;HAWKES M;LOBIN S;MILLER C;YANG Z; | -STAT CORPORATION; | The invention relates to compositions and methods for the immunoassay of an analyte of interest. The analyte is detected in an immunoassay using three or more antibodies, wherein each antibody specifically binds to a different epitope on the analyte. When the analyte of interest in a clinical marker for an acute disease, the detection of the analyte by immunoassay is a diagnosis of the occurrence of the disease | 2003 Jul 29 | 2004 Feb 5 |
| WO04012681 | CANCER VACCINES CONTAINING EPITOPES OF ONCOFETAL ANTIGEN | COGGIN J;ROHRER J;BARSOUM A; | SOUTH ALABAMA MEDICAL SCIENCES FOUNDATION; | Disclosed are fragments of oncofetal antigen, otherwise known as immature laminin receptor protein that specifically stimulate one T cell subclass. The fragments may be formulated into compositions for potentiating T cell-mediated response in mammalian cancer patients. They also have therapeutic uses in vitro | 2003 Aug 4 | 2004 Feb 12 |
| WO04013166 | S. AUREUS ANTIGENE | VON AHSEN U;S?LNER J;WEICHHART T;HAFNER M; | INTERCELL AG; | Described are novel antigens from S. aureus selected from the group consisting of Seq.ID.Nos. 7 to 12, as well as their use in a pharmaceutical preparation, especially in a vaccine | 2003 Jul 22 | 2004 Feb 12 |
| WO04014292 | EphA2 AGONISTIC MONOCLONAL ANTIBODIES AND METHODS OF USE THEREOF | KINCH M;CARLES-KINCH K; | PURDUE RESEARCH FOUNDATION; | The present invention relates to methods and compositions designed for the treatment, management, or prevention of cancer, particularly, metastatic cancer. The methods of the invention comprise the administration of an effective amount of one or more antibodies that bind to and agonize EphA2, thereby increasing EphA2 phosphorylation and decreasing EphA2 levels in cells which EphA2 has been agonized. The invention also encompasses antibodies that preferentially bind an EphA2 epitope exposed on cancer cells but not non-cancer cells. The invention also provides pharmaceutical compositions comprising one or more EphA2 antibodies of the invention either alone or in combination with one or more other agents useful for cancer therapy | 2003 May 12 | 2004 Feb 19 |
| WO04014956 | NOVEL IMMUNOGENIC LIPOPEPTIDES COMPRISING T-HELPER AND B-CELL EPITOPES | JACKSON D;ZENG W; | THE COUNCIL OF THE QUEENSLAND INSTITUTE OF MEDICAL RESEARCH; | The present invention provides synthetic immunogenic lipopeptide molecules comprising co-linear T-helper and B cell epitopes, and methods for their production and use in the generation of primary and secondary immune responses, and for the vaccination of animal subjects against particular antigens. More particularly, the present invetion provides highly soluble lipopeptides wherein the lipid moiety is attached to the terminal side-chain group of an internal lysine or lysine analog, preferably to the terminal side-chain group of an internal diamino acid residue. Preferably the internal lysine or lysine analog is positioned between the T-helper epitope and the B cell epitope or within the T-helper epitope | 2003 Aug 12 | 2004 Feb 19 |
| WO04015057 | FUSION PROTEINS AND METHODS OF PRODUCING SAME | HOLGERSSON J;LIU J;GUSTAFSSON A; | ABSORBER AB; | The present invention provides compositions and methods for treating or preventing hyperacute rejection | 2003 Aug 11 | 2004 Feb 19 |
| WO04015395 | METHOD FOR IDENTIFYING MHC-PRESENTED PEPTIDE EPITOPES FOR T CELLS | KAPPLER J;CRAWFORD F;MARRACK P; | NATIONAL JEWISH MEDICAL AND RESEARCH CENTER; | Described are three basic components: (1) methods for the display of functional MHC molecules with covalently attached antigenic peptides on the surface of baculovirus and baculovirus infected insect cells; (2) methods for the identification and physical isolation of baculovirus or baculovirus infected insect cells bearing a displayed MHC/peptide combination that is recognized by a particular T cell antigen receptor; and (3) methods for producing libraries of baculovirus or baculovirus infected insect cells displaying a particular MHC molecule and many different potential antigenic peptides | 2003 Aug 13 | 2004 Feb 19 |
| WO04016230 | IDENTIFICATION OF THE ENDOTHELIAL RECEPTOR FOR THE ANGIOSTATIN KRINGLE-5 | PIZZO S;GONZALEZ-GRONOW M; | DUKE UNIVERSITY; | An isolated antibody that binds to a plasminogen kringle 5 receptor, i.e., the human voltage-dependent anion channel, preferably at an epitope between amino acids Tyr224 through Lys255 thereof, is described, along with methods of use thereof. Peptides or immunogens that stimulate the production of such antibodies, along with methods of use thereof, are also disclosed | 2003 Aug 14 | 2004 Feb 26 |
| WO04016643 | TUMOR ASSOCIATED ANTIGEN, PEPTIDES THEREOF, AND USE OF SAME AS ANTI-TUMOR VACCINES | EISENBACH L;TIROSH B;CARMON L;MACHLENKIN A;PAZ A;TZEHOVAL E;FRIDKIN M; | YEDA RESEARCH AND DEVELOPMENT CO.LTD.;MCINNIS P; | The invention relates to colon and prostate tumor associated antigen peptides obtainable from prostate specific G protein-coupled receptor (PSGR), six-transmembrane epithelial antigen of prostate (STEAP) and proteins encoded by genes found overexpressed in colon carcinoma cells, such as human 1-8D interferon induced transmembrane protein 2. The invention further relates to a polynucleotide encoding the tumor associated antigen peptides and to pharmaceutical compositions, which are preferably anti-tumor vaccine compositions, containing a tumor associated antigen, at least one tumor associated antigen peptide thereof, or encoding polynucleotide thereof as an active ingredient. The pharmaceutical compositions can be administered to a patient in need thereof to treat or inhibit the development of colon or prostate cancer | 2003 Jul 28 | 2004 Feb 26 |
| WO04018511 | COMPOSITE PEPTIDE COMPOUNDS FOR DIAGNOSIS AND TREATMENT OF DISEASES CAUSED BY PRION PROTEINS | HEEGAARD P;JAKOBSEN P; | COPENHAGEN BIOTECH ASSE; | The present invention relates to diseases caused by prion proteins, Novel composite peptide compounds are disclosed which comprise two or more peptides or peptide fragments optionally linked to a backbone and the peptides or peptide fragments are spatially positioned relative to each other so that they together form a non-linear sequence which mimics the tertiary structure of one or more PrPSc-specific epitopes as evidenced by the test described herein. The use of such conjugates as immunogens for the production of antibodies that specifically bind to the pathogenic form of a prion protein is revealed. Other uses of the composite peptide compounds are also disclosed, such as use in diagnostic assays, production of antibodies and uses as vaccine immunogens for the prophylactic protection and therapeutic treatment of subjects against transmissible prion disease | 2003 Aug 25 | 2004 Mar 4 |
| WO04018520 | CHIMERIC MHC PROTEIN AND OLIGOMER THEREOF | SCHWABE N;CHENG-CHOO TAN L;NAPPER C;FRY J;PANG S;SPOONER R; | PROIMMUNE LIMITED; | The invention concerns a Oligomeric MHC complex comprising at least two chimeric proteins, said chimeric proteins comprising a first section derived from an MHC peptide chain or a functional part thereof and a second section comprising an oligomerising domain derived from an oligomer-forming coiled-coil protein, wherein formation of the oligomeric MHC complex occurs by oligomerisation at the oligomerising domain of the chimeric proteins, and wherein at least two of the first sections are derived from the same MHC peptide chain. The invention also concerns a chimeric protein comprising a first section derived from a MHC peptide chain or a functional part thereof and a second section comprising an oligomerising domain derived from an oligomer-forming coiled-coil protein. The invention further concerns a method of labeling and/or detecting mammalian T cells according to the specificity of their antigen receptor, by combining an oligomeric MHC complex according to one of claims 1 to 12 and a suspension or biological sample comprising T cells, and detecting the presence of specific binding of said complex and the T cells. Finally the invention concerns a primer consisting of a DNA sequence for genetic engineering of the above chimeric protein | 2003 Aug 14 | 2004 Mar 4 |
| WO04018683 | STREPTOCOCCUS UBERIS PROTEIN, NUCLEIC ACID SEQUENCE ENCODING THE SAME AND ITS USE IN A MASTITIS VACCINE | HENSEN S;NUIJTEN P; | AKZO NOBEL NV; | The present invention relates to nucleic acid sequences encoding a 22.5 kD Streptococcus uberis protein and to parts of such nucleic acid sequences that encode an immunogenic fragment of such proteins, and to DNA fragments, recombinant DNA molecules, live recombinant carriers and host cells comprising such nucleic acid sequences or such parts thereof. The invention also relates to a 22.5 kD Streptococcus uberis protein and immunogenic parts thereof encoded by such sequences. Furthermore, the present invention relates to vaccines comprising such nucleic acid sequences and parts thereof, DNA fragments, recombinant DNA molecules, live recombinant carriers and host cells comprising such nucleic acid sequences or such parts thereof, proteins or immunogenic parts thereof and antibodies against such proteins or immunogenic parts thereof. Also, the invention relates to the use of said proteins in vaccines and for the manufacture of vaccines. Moreover, the invention relates to the use of said nucleic acid sequences, proteins or antibodies for diagnostic or vaccination purposes. Finally the invention relates to diagnostic kits comprising such a nucleic acid, protein or antibodies against such protein | 2003 Aug 6 | 2004 Mar 4 |
| WO04019974 | VACCINE | ELLIS J; | GLAXO GROUP LIMITED;ASHMAN C; | The present invention relates to isolated immunogens and their use in the treatment of diseases that are treatable with neutralisation of IL-13, such as COPD, asthma and atopic disorders such as hayfever, contact allergies and atopic dermatitis. In particular the invention relates to the neutralisation of the biological effects of IL-13 by raising an immune response against the IL-13 by vaccination of a mammal with immunogens comprising the native or mutated amino acid sequence of IL-13, and foreign T-helper epitopes either inserted in, or attached to the IL-13 sequence or present in carrier polypeptides. Also provided by the present invention are DNA vaccines that comprise a polynucleotide sequence that encodes the immunogens of the present invention. The invention further relates to pharmaceutical compositions comprising such immunogens and their use in medicine and to methods for their production | 2003 Aug 28 | 2004 Mar 11 |
| WO04019976 | PHARMACEUTICAL LIPOSOMAL COMPOSITIONS CONTAINING N. MENINGITIDIS DERIVED POLYPEPTIDES OR POLYNUCLEOTIDES | MARTIN D;RIOUX S; | SHIRE BIOCHEM I; | Pharmaceutical compositions comprising a liposome associated to N. meningitidis polypeptides fragments or analogs thereof or corresponding DNA fragments, can be used to prevent, diagnose and/or treat neisserial infections | 2003 Aug 29 | 2004 Mar 11 |
| WO04021013 | A METHOD OF ANALYSING RELATIVE EPITOPE APPEARANCE IN A PLURALITY OF SAMPLES | BERGERVOET J; | PLANT R; | The invention provides a method and materials for monitoring and isolating differentially expressed epitopes. In accordance with the method of the invention, differently labelled populations of epitopes from sources to be compared are competitively bound with a display library to provide a differential expression library which, in the preferred embodiment, may be manipulated by fluorescence-activated cell sorting (FACS). Monitoring the relative signal intensity of the different fluorescent labels on the reference display library permits quantitative analysis of expression levels relative to the reference sample. The invention also provides a method for identifying and isolating rare epitopes etc. Populations of display library having relative signal intensities of interest can be isolated by FACS and the attached epitopes etc. can be identified by two dimensional electrophoresis and, or MS-MS sequencing. Selected organisms can be isolated by FACS and cultivated or used as starting material for differential protein screening | 2003 Aug 13 | 2004 Mar 11 |
| WO04021977 | NUCLEIC ACID AND CORRESPONDING PROTEIN ENTITLED 98P4B6 USEFUL IN TREATMENT AND DETECTION OF CANCER | CHALLITA-EID P;RAITANO A;FARIS M;GE W;JAKOBOVITS A; | AGENYSYS I; | A novel gene 098P4B6 (also designated STEAP-2) and its encoded protein, and variants thereof, are described wherein 98P4B6 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 98P4B6 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 98P4B6 gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 98P4B6 can be used in active or passive immunization | 2003 Jun 11 | 2004 Mar 18 |
| WO04024090 | IMMUNOGENS AND CORRESPONDING ANTIBODIES SPECIFIC FOR HIGH MOLECULAR WEIGHT AGGREGATION INTERMEDIATES COMMON TO AMYLOIDS FORMED FROM PROTEINS OF DIFFERING SEQUENCE | KAYED R;GLABE C; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA; | Compositions of matter that comprise one or more conformational epitopes found on amyloid peptide aggregates, antibodies to such epitopes and methods for making and using the compositions, eptitopes and/or antibodies. The invention includes synthetic or isolated compositions that contain or consist of certain conformational epitopes that are found on peptide aggregates (e.g., toxic peptide aggregates) present in human or veterinary patients who suffer from, or who are likely to develop, amyloid diseases (e.g., Alzheimer's Disease). The invention includes methods for the detection, treatment and prevention of diseases in humans or animals, using such compositions. The invention further includes antibodies which bind to the conformational epitopes as well as methods for making such antibodies and methods for the detection, treatment and prevention of diseases and/or identification of potential therapies (e.g., drug screening) using such antibodies | 2003 Sep 12 | 2004 Mar 25 |
| WO04024175 | CANCER ANTIGEN PEPTIDE PREPARATION | SUGIYAMA HARU; | SUGIYAMA H; | It is intended to provide WT1-origin cancer antigen peptides which are useful in vivo, in particular, in the clinical field and an administration dosage form of these cancer antigen peptides as a vaccine for cancer. Namely, a water-in-oil type emulsion containing, as the active ingredient(s), one or both of a peptide having the amino acid sequence Cys Met Thr Trp Asn Gln Met Asn Leu (SEQ ID NO:2) and another peptide having the amino acid sequence Cys Tyr Thr Trp Asn Gln Met Asn Leu (SEQ ID NO:3), and a process for producing the same | 2003 Sep 12 | 2004 Mar 25 |
| WO04024771 | HUMAN CD3-SPECIFIC ANTIBODY WITH IMMUNOSUPPRESSIVE PROPERTIES | LE GALL F;KIPRIYANOV S;LITTLE M;REUSCH U; | AFFIMED THERAPEUTICS AG; | Described are mono- and multivalent scFv-antibodies comprising the binding sites specific for the human T cell marker CD3. These antibodies are strongly immunosuppressive and do not cause a significant release of cytokines. Furthermore, polynucleotides encoding said antibodies are described as well as vectors comprising said polynucleotides, host cells transformed therewith and their use in the production of said antibodies. Pharmaceutical compositions containing any of the above mentioned polynucleotides, antibodies or vectors are useful for immunotherapy, preferably against acute transplant rejections | 2003 Sep 10 | 2004 Mar 25 |
| WO03089611 | ANTIBODIES FOR ENZYMES OF THE OMEGA-OXIDATION PATHWAY AND METHODS RELATING THERETO | ZHANG Y;WILSON C; | COGNIS CORPORATION; | The present invention provides antigenic peptides useful for the production of antibodies which selectively bind to an enzyme involved in the omega-oxidation of fatty acids and alkanes to alpha,omega-dicarboxylic acids in yeast. Antibodies which specifically bind to an enzyme involved in the omega;-oxidation of fatty acids and alkanes to alpha,omega-dicarboxylic acids in yeast are also provided. In addition, methods of producing the subject antibodies, a method of detecting the presence and amount of a specific enzyme involved in the omega-oxidation of fatty acids and alkanes to alpha,omega-dicarboxylic acids, and a method of monitoring the degree of enzyme induction and/or enzyme stability in a mixture during omega-oxidation of fatty acids and alkanes to a,omega-dicarboxylic acids in yeast, are also provided | 2003 Apr 18 | 2003 Oct 30 |
| WO03094958 | IMMUNOPROTECTIVE METHODS FOR BETA CELL NEOGENESIS | VAN ANTWERP W; | MEDTRONIC MINIMED I; | The invention is based on the disclosure provided herein that a biologically active fragment of pancreatitis associated polypeptide can be used to stimulate beta cell growth and at the same avoid and overcome the T-cell mediated autoimmune attack on the pancreas. Typical embodiments of the invention include methods of inhibiting the onset of Type I diabetes in a mammalian subject predisposed to Type I diabetes comprising administering to the subject a therapeutically effective amount of a pancreatitis associated polypeptide comprising the amino acid sequence IGLHDPTQGTEPNGE (SEQ ID NO: 3) | 2003 May 9 | 2003 Nov 20 |
| WO03096984 | DRUG THERAPY FOR CELIAC SPRUE | GRAY G;KIM CY; | THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY;SOLLID L;HAUSCH F;SHAN L;KHOSLA C;QUARSTEN H; | Celiac Sprue and/or dermatitis herpetiformis are treated by interfering with HLA binding of immunogenic gluten peptides. The antigenicity of gluten oligopeptides and the ill effects caused by an immune response thereto are decreased by administration of an HLA-binding peptide inhibitor. Such inhibitors are analogs of immunogenic gluten peptides and (i) retain the ability to bind tightly to HLA molecules; (ii) retain the proteolytic stability of these peptides; but (iii) are unable to activate disease-specific T cells | 2003 May 14 | 2003 Nov 27 |
| WO03097673 | CHIMAERIC HUMAN PAPILLOMAVIRUS 16 L1 VIRUS LIKE PARTICLES AND A METHOD FOR PREPARING THE PARTICLES | VARSANI A;RYBICKI E; | UNIVERSITY OF CAPE TOWN; | The invention describes a method for producing a chimaeric human papillomavirus (HPV) L1 polypeptide containing a heterologous peptide, and in particular, a HPV L2 peptide. The method comprises the steps of introducing a DNA sequence coding for the heterologous peptide into a DNA sequence coding for the L1 polypeptide; introducing the DNA sequence including the sequences for the L1 polypeptide and heterologous peptide into a host cell in which the DNA sequence can be expressed; causing expression of the DNA sequence; and recovering the resulting chimaeric L1 polypeptide which includes the heterologous peptide. Typically, the nucleotides encoding the heterologous peptide replace the nucleotides of the L1 polypeptide at the point of insertion. The invention also describes a vector for use in the method, a host cell containing the vector, and a vaccine including the chimaeric HPV L1 polypeptide produced according to the method | 2003 May 19 | 2003 Nov 27 |
| WO03097796 | T7 BACTERIOPHAGE DISPLAY OF FABS | ROTHER RUSS;GEIS DAVI; | ALEXION PHARMACEUTICALS I;ROTHER R;GEIS D; | A T7 bacteriophage vector which displays Fab fragments is disclosed. Host cells and methods of making the bacteriophage are also described | 2003 May 13 | 2003 Nov 27 |
| WO03098219 | AN ELISA MEASURING DE NOVO PEPTIDE-MHC INTERACTION | BUUS Sr;SILVESTER-HVID C; | UNIVERSITY OF COPENHAGEN; | The present invention relates to a quantitative method to measure the interaction between a peptide and a MHC molecule. The basis for measuring this interaction is substantially pure denatured MHC heavy chains. These denatured MHC heavy chains are subsequently renatured in a buffer containing excess of beta 2m and an increasing concentration of the peptide in question, leading to a de novo folding and generation of peptide-MHC complexes. The present invention is exemplified with reference to MHC class I proteins, but it is envisaged that it is possible on a similar manner to generate data from any type of complex where de novo folding is peptide dependent, e.g., MHC class II | 2003 May 15 | 2003 Nov 27 |
| WO03099250 | SUNSCREEN COSMETIC COMPOSITIONS STORAGE STABILIZED WITH MALONATE SALTS | ZHANG J;FARYNIARZ J;CHENEY M; | UNILEVER PLC;UNILEVER NV;HINDUSTAN LEVER LIMITED; | A cosmetic composition is provided which includes an organic sunscreen agent and at least one salt of a malonic acid. The malonate salt inhibits discoloration which may arise from the presence of the sunscreen agent. Of particular concern in forming color bodies is 4,4'-t-butyl-methoxydibenzoylmethane | 2003 May 22 | 2003 Dec 4 |
| WO03099860 | IMMUNOGENIC COMPOSITION AND PEPTIDE SEQUENCES FOR PREVENTION AND TREATMENT OF AN HSV CONDITION | GEORGES B;GRAS-MASSE H;BENMOHAMED L;NESBURN A; | SOCIETE D'ETUDE ET DE DEVELOPPEMENT DES ANTIGENES COMBINATOIRES - SEDAC THERAPEUTICS; | Immunogenic composition comprising at least one Herpes Simplex Virus type 1 (HSV-1) and/or type 2 (HSV-2) peptide sequence bearing at least one epitope from glycoprotein D (gD) and/or glycoprotein B (gB), a pharmaceutical carrier and/or a human compatible adjuvant, peptide sequences and uses thereof for prevention or treatment of an HSV condition | 2003 May 23 | 2003 Dec 4 |
| WO03100007 | ETA-1 GENE AND METHODS FOR USE | WINSLOW B;KALABAT D; | SCHERING-PLOUGH LTD.; | The present application relates to osteopontin (Eta-1) polypeptides, nucleic acids that encode Eta-1, antibodies that specifically bind to Eta-1, and methods for enhancing an immune response in an animal | 2003 May 22 | 2003 Dec 4 |
| WO03103706 | IMMUNOGENIC COMPOSITIONS | CASSART JP;GERARD C;HAMBLIN P;PALMANTIER R; | GLAXOSMITHKLINE BIOLOGICALS SA;GLAXO GROUP LIMITED; | The present invention relates to pharmaceutical/immunogenic compositions and methods for inducing an immune response against tumour-related antigens. More specifically, the invention relates to non-human prostate-specific antigens, more precisely to the non-human prostate-specific P501S, which can be used as xenogeneic antigen in prostate cancer vaccine therapy and as diagnostic agents for prostate tumours in humans, to immunogenic compositions containing them, to methods of manufacture of such compositions and to their use in medicine. Methods for formulating vaccines for immunotherapeutically treating P501S-expressing prostate tumors, prostatic hyperplasia, and prostate intraepithelilial neoplasia (PIN) are also provided | 2003 Jun 6 | 2003 Dec 18 |
| WO03103724 | NEUTROPHIL IMAGING IN CYSTIC FIBROSIS | SODEE B;KONSTAN M;GOLDENBERG D; | IMMUNOMEDICS I;MCCALL J; | The present invention is directed to an improved method to detect and monitor a subject having cystic fibrosis (CF) by employing a murine anti-NCA 90 monoclonal antibody Fab' fragment and99m-technetium. It is further directed to a simple, noninvasive, and effective test that can assess neutrophil delivery to the lower airways of patients with CF and other neutrophil-mediated lung diseases | 2003 Jun 3 | 2003 Dec 18 |
| WO03104259 | PEPTIDES PRESENTED BY HLA-B18 AND Cw16 MOLECULES, AND USES THEREOF | BILSBOROUGH J;ZHANG Y;SCHULTZ E;PANICHELLI C;VAN DER BRUGGEN P;BOON-FALLEUR T;TRAVERSARI C; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | Peptides, previously identified as binding partners of HLA-B44, HLA-Cw3 and HLS-Cw16 have now been found to bind to HLA-B18 and HLA-Cw6 forming T cell epitopes. The therapeutic and diagnostic ramifications of this are the subjects of this invention, as are various products obtained in the course of the development of the invention | 2003 Jun 4 | 2003 Dec 18 |
| WO03104263 | CYTOKINES AND CYTOKINE RECEPTORS WITH REDUCED IMMUNOGENICITY | HARDING F;POWER S; | GENENCOR INTERNATIONAL I; | The present invention provides methods for the identification of CD4+ T-cell epitopes in the sequences of various proteins, namely, human cytokines and cytokine receptors, as well as the production of peptides which when incorporated into the protein sequence, are no longer capable of initiating the CD4+ T-cell response. In some embodiments, the present invention provides means and compositions suitable for reducing the immunogenicity of cytokines and cytokines receptors such as interferon-beta, soluble tumor necrosis factor receptor-1, erythropoietin, and thrombopoietin | 2003 Feb 26 | 2003 Dec 18 |
| WO03104273 | THERAPEUTIC EPITOPES AND USES THEREOF | ANDERSON R;HILL A;JEWELL D; | ISIS INNOVATION LIMITED; | The invention herein disclosed is related to epitopes useful in methods of diagnosing, treating, and preventing coeliac disease. Therapeutic compositions which comprise at least one epitope are provided | 2003 Jun 5 | 2003 Dec 18 |
| WO03104428 | GENE DIFFERENTIALLY EXPRESSED IN BREAST AND BLADDER CANCER AND ENCODED POLYPEPTIDES | ZAUDERER M;EVANS EE;BORRELLO MA; | VACCINEX I;UNIVERSITY OF ROCHESTER; | The present invention relates to a novel human gene that is differentially expressed in human carcinoma. More specifically, the present invention relates to a polynucleotide encoding a novel human polypeptide named C35 that is overexpressed in human breast and bladder carcinoma. This invention also relates to C35 polypeptide, in particular C35 peptide epitopes and C35 peptide epitope analogs, as well as vectors, host cells, antibodies directed to C35 polypeptides, and the recombinant methods for producing the same. The present invention further relates to diagnostic methods for detecting carcinomas, including human breast carcinomas. The present invention further relates to the formulation and use of the C35 gene and polypeptides, in particular C35 peptide epitopes and C35 peptide epitope analogs, in immunogenic compositions or vaccines, to induce antibody or cell-mediated immunity against target cells, such as tumor cells, that express the C35 gene. The invention further relates to screening methods for identifying agonists and antagonists of C35 activity | 2003 Jun 10 | 2003 Dec 18 |
| WO03104432 | ANTI-CD30 STALK AND ANTI-CD30 ANTIBODIES SUITABLE FOR USE IN IMMUNOTOXINS | PASTAN I;NAGATA S;ONDA M;NUMATA Y;SANTORA K;BEERS R;KREITMAN R;SINHA A; | THE GOVERNMENT OF THE UNITED STATES ARBTSOTDOHAHS; | CD30 is a receptor expressed on cells of Hodgkin's disease and certain leukemias. The extracellular portion of CD30 is cleaved, releasing a form known as sCD30. The invention relates in part to the discovery that a residual, extracellular 'stalk' of CD30 remains after cleavage of sCD30. The stalk provides an advantageous and previously unrecognized target for immunotoxins. The invention provides antibodies that bind to the CD30 stalk or to epitopes destroyed upon the cleavage of CD30 which results in the stalk. The invention further provides new anti-CD30 antibodies that form effective immunotoxins and are particularly suitable for making disulfide stabilized Fv ('dsFv')-immunoconjugates. The dsFv immunoconjugates can be used as reagents to label CD30-expressing cancer cells or to inhibit the growth of CD30-expressing cancer cells. Moreover, the invention provides anti-CD30 antibodies that activate complement-dependent cytotoxicity | 2003 Jun 9 | 2003 Dec 18 |
| WO03104803 | METHOD FOR MAPPING AND ELIMINATING T-CELL EPITOPES | BAKER M;CARR F;CARTER G; | MERCK PATENT GMBH; | The invention provides screening methods for the identification of determinants and epitopes on protein molecules able to evoke an immune response. In particular the invention is concerned with the identification of epitopes for T-cells in therapeutic proteins. Finally, the invention relates to a combined approach of using epitope mapping in concert with the identification of MHC class II ligands deriving from said epitope mapping method and design of sequence analogous having a reduced number of such ligands and epitopes, respectively | 2003 Jun 11 | 2003 Dec 18 |
| WO03105058 | METHOD, COMPUTING ROUTINE, DEVICE FOR PREDICTING PROPERTIES OF MHC/PEPTIDE COMPLEXES, AND DATA AND PEPTIDES PRODUCED THEREFROM | LASTERS I;DESMET J; | ALGONOMICS NV; | The present invention relates to a method for structure-based prediction of properties of peptides and peptide analogs in complex with major histocompatibility (MHC) class I and class II molecules. The said properties mainly relate to the three-dimensional structure of an MHC/peptide complex and the binding affinity of a peptide for an MHC receptor. The invention further relates to a computer program and a device therefor. The invention further relates to data produced by a method of the invention. The invention further relates to peptides and peptide analogs predicted to bind to target-MHC molecules. The present invention thus relates to the field of immunology, with possible applications in manufacture of vaccinates, de-immunization of proteins, and manufacture of therapeutic agents, especially immunotherapeutic agents | 2003 Jun 10 | 2003 Dec 18 |
| WO03106627 | CANCER-LINKED GENE AS TARGET FOR CHEMOTHERAPY | EVANS K;EBNER R; | AVALON PHAR; | Cancer-linked gene sequences, and derived amino acid sequences, are disclosed along with processes for assaying potential antitumor agents based on their modulation of the expression of these cancer-linked genes. Also disclosed are antibodies that react with the disclosed polypetides and methods of using the antibodies to treat cancerous conditions, such as by using the antibody to target cancerous cells in vivo for purposes of delivering therapeutic agent thereto. Also described are methods of diagnosing using the gene sequences | 2003 Jun 12 | 2003 Dec 24 |
| WO03106692 | METHODS FOR THE IDENTIFICATION OF ALL-ANTIGENS AND THEIR USE FOR CANCER THERAPY AND TRANSPLANTATION | STRITTMATTER W;MOLL H; | MERCK PATENT GMBH; | The present invention delivers a new concept with respect to the broad definition of alto-antigens that drive graft-versus-tumor (GVT) reactions and/ or graft-versus-host disease (GVHD). The new method for the identification of allo-antigens, which has so far been an unresolved technical problem, furthermore calls for new strategies in immunotherapy. Because the analysis of HLA-binding proteins can now be done with alloantigens for which the corresponding amino-acid sequence is known, the present invention also allows the separation of alto-reactive T cells that only recognize tumor cells from those that mediate GVHD. Antigens defined with the new technology are especially useful for diagnosis and vaccination in cancer and transplantation-related diseases | 2003 Jun 13 | 2003 Dec 24 |
| WO4000217 | VACCINES FOR SUPPRESSING IGE-MEDIATED ALLERGIC DISEASE AND METHODS FOR USING THE SAME | LEVINSON A;CALAROTA S;WEINER D;OTERO M; | THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA; | Nucleic acid molecules that encode a protein comprising at least one epitope of membrane IgE free of epitopes present on the serum IgE, including proteins that further comprise non-IgE T cell helper epitope are disclosed. Vaccines, vectors and host cells that comprise such nucleic acid molecules are disclosed. Isolated proteins, including haptenized proteins, comprising at least one epitope of membrane IgE free of epitopes present on the serum IgE, including proteins that further comprise non-IgE T cell helper epitope are disclosed. Vaccines that comprise and methods of making such proteins and antibodies that specifically bind to such proteins are disclosed. Killed or inactivated cells or particles, including haptenized killed or inactivated cells or particles, that comprise a protein comprising at least one epitope of membrane IgE free of epitopes present on the serum IgE, including proteins that further comprise non-IgE T cell helper epitope are disclosed. Vaccines that comprise such killed or inactivated cells or particles are disclosed. Methods of treating and preventing IgE mediated allergic disease or condition are disclosed | 2003 Jun 20 | 2003 Dec 31 |
| WO04000873 | ADJUVANT-FREE PEPTIDE VACCINE | DIAMOND D; | CITY OF HOPE; | Linking the synthetically-derived T helper epitope, PADRE, or one of several tetanus TH epitopes to the immunodominant HLA A*0201-restricted CTL epitope from CMV-pp65 in a fusion peptide caused robust cytotoxic cellular immune responses in HLA A*0201/Kb transgenic mice. The fusion peptides are immunogenic when administered in saline solution by either subcutaneous or intranasal routes. CpG-containing single-stranded DNA (ss-ODN), when added to the fusion peptides as an adjuvant, dramatically upregulated immune recognition by either route. Target cells which either expressed full length pp65 protein from vaccinia viruses or were sensitized with the CTL epitope encoded in the vaccine were recognized by splenic effectors from immunized animals. TH-CTL epitope fusion peptides in combination with CpG ss-ODN (DNA adjuvant) represents a strategy useful for parenteral or mucosal delivery of vaccines in a safe and effective manner that has applicability for control or prophylaxis of infectious disease, especially in situations such as vaccination of donors or recipients of HCT, where highly inflammatory adjuvants are not desired | 2003 Jun 25 | 2003 Dec 31 |
| WO04001424 | MATERIALS AND METHODS FOR INDUCTIONS OF IMMUNE TOLERANCE | BARKER R;MARSHALL N;VICKERS M; | UNIVERSITY COURT OF THE UNIVERSITY OF ABERDEEN; | The invention provides methods of inducing immune tolerance to target antigens in individuals seropositive for certain infectious agents by administration of epitopes derived from those infectious agents. Epitopes derived from viruses which carry homologues of interleukin 10 (IL-10) in their genome, such as Epstein Barr virus and cytomegalovirus, are particularly suitable for these purposes. Particularly preferred is the use of the EBV LMP1 protein and epitopes thereof | 2003 Jun 24 | 2003 Dec 31 |
| WO04018498 | MINICELL DISPLAY AND PRODUCTS THEREFROM | ASHKAR S; | CHILDREN'S MEDICAL CENTER CORPORATION; | A minicell display method has been developed which has significant advantages for screening peptide libraries for candidates that can bind and effectively modulate a particular biological process. The method, based on the small, anucleate minicell, has increased versatility in generating unique sequences to screen as well as increasing the size of the peptides to be screened. In vivo mutagenesis, at the level of protein synthesis, as well as DNA replication, increases diversification of the library to be screened and therefore substantially increases the number of potential peptides that can modulate a particular biological response or mechanism. A number of representative peptides have been generated using this methodology and demonstrated to have desirable biological and pharmaceutical activities | 2003 May 6 | 2004 Mar 4 |
| WO03104407 | T CELL RECEPTOR CDR3 SEQUENCES AND METHODS FOR DETECTION | ZHANG J; | BAYLOR COLLEGE OF MEDICINE;OPEXA PHARMACEUTICALS INC.; | The present invention relates generally to the field of treating autoimmune diseases, such as multiple sclerosis (MS), rheumatoid arthritis (RA) and others. Methods of treating and monitoring an autoimmune disease by utilizing T-cell receptors peptides are disclosed. Nucleic acid and peptide sequences of T-cell receptors found in a population of MS patients are also disclosed | 2003 Jun 5 | 2003 Dec 18 |
| WO04113388 | MONOCLONAL ANTIBODIES THAT SPECIFICALLY BIND A TUMOR ANTIGEN | GRASSO L;NICOLAIDES N;SASS P; | MORPHOTEK I; | Monoclonal antibodies that specifically bind to the tetrameric form of the alpha-folate receptor and not the monomeric form are provided. The antibodies are useful in the treatment of certain cancers, particularly cancers that have increased cell surface expression of the alphafolate receptor ('FR-a'), such as ovarian cancer. Hybridoma cells expressing the monoclonal antibodies, antibody derivatives, such as chimeric and humanized monoclonal antibodies, antibody fragments, mammalian cells expressing the monoclonal antibodies, derivatives and fragments, and methods of detecting and treating cancer using the antibodies, derivatives and fragments also are provided | 2004 May 21 | 2004 Dec 29 |
| WO04071457 | IMPROVED HEAT SHOCK PROTEIN-BASED VACCINES AND IMMUNOTHERAPIES | FLETCHNER J;PRINCE-COHANE K;MEHTA S;SLUSAREWICZ P;ANDJELIC S;BARBER B; | MOJAVE THERAPEUTICS I; | Hybrid antigens comprising an antigenic domain and improved heat shock protein binding domains are described which are useful for the induction of an immune response to the antigenic domain and thus can be used to treat infectious diseases and cancers that express an antigen of the antigenic domain | 2004 Feb 13 | 2004 Aug 26 |
| WO04071408 | Abeta BINDING MOLECULES | DAVIES J;TANG Y;WATKINS J; | APPLIED MOLECULAR EVOLUTION I; | The present invention encompasses isolated antibodies, or fragments thereof, that are humanized variants of murine antibody 266 which employ complementarity determining regions derived from murine antibody 266. The variant antibodies are useful for treatment or prevention of conditions and diseases associated with Abeta, including Alzheimer's disease, Down's syndrome, cerebral amyloid angiopathy, mild cognitive impairment, and the like | 2004 Feb 6 | 2004 Aug 26 |
| WO04074321 | NOVEL THERAPEUTIC GPCR TARGETS IN CANCER | MORRIS D;MALANDRO M; | SAGRES DISCOVERY I; | The present invention relates to novel sequences for use in detection, diagnosis and treatment of cancers, especially lymphomas. The invention provides cancer-associated (CA) polynucleotide sequences whose expression is associated with cancer. The present invention provides CA polypeptides associated with cancer that are present on the cell surface and present novel therapeutic targets against cancer. This invention relates to G-protein coupled receptor (GPCR) sequences. The present invention further provides diagnostic compositions and methods for the detection of cancer. The present invention provides monoclonal and polyclonal antibodies specific for the CA polypeptides. The present invention also provides diagnostic tools and therapeutic compositions and methods for screening, prevention and treatment of cancer | 2004 Feb 17 | 2004 Sep 2 |
| WO04074322 | MODIFIED SOLUBLE T CELL RECEPTOR | JAKOBSEN B;GLICK M; | AVIDEX LTD; | The present invention provides a soluble T cell receptor (sTCR), which comprises (i) all or part of a TCR g(a) chain, except the transmembrane domain thereof, and (ii) all or part of a TCR g(b) chain, except the transmembrane domain thereof. (i) and (ii) each comprise a functional variable domain and at least a part of the constant domain of the TCR chain, and are linked by a disulphide bond between constant domain residues which is not present in native TCR, characterised in that the sTCR recognises a CD1-antigen complex, a bacterial superantigen or a peptide-MHC/superantigen complex | 2003 Jul 9 | 2004 Sep 2 |
| WO04074320 | NOVEL THERAPEUTIC TARGETS IN CANCER | MORRIS D;MALANDRO M; | SAGRES DISCOVERY I; | The present invention relates to novel sequences for use in detection, diagnosis and treatment of cancers, especially lymphomas. The invention provides cancer-associated (CA) polynucleotide sequences whose expression is associated with cancer. The present invention provides CA polypeptides associated with cancer that are present on the cell surface and present novel therapeutic targets against cancer. The present invention further provides diagnostic compositions and methods for the detection of cancer. The present invention provides monoclonal and polyclonal antibodies specific for the CA polypeptides. The present invention also provides diagnostic tools and therapeutic compositions and methods for screening, prevention and treatment of cancer | 2004 Feb 17 | 2004 Sep 2 |
| WO04074454 | METHODS AND COMPOSITIONS FOR THE TREATMENT OF CANCER AND INFECTIOUS DISEASE USING ALPHA (2) MACROGLOBULIN-ANTIGENIC MOLECULE COMPLEXES | SRIVASTAVA P;BINDER R; | UNIVERSITY OF CONNECTICUT HEALTH CENTER; | The present invention relates to the use of alpha (2) macroglobulin complexes isolated from the serum of a mammal. The invention also relates to methods for making such complexes and compositions comprising alpha (2) macroglobulin complexes, isolated from the serum of a mammal, wherein such compositions are used in methods for the treatment and prevention of cancer and infectious disease. The invention also relates to methods for treating and preventing cancer and infectious disease using such complexes comprising, isolated from the serum of a mammal. The invention also encompasses methods for production of alpha (2) macroglobulin complexes | 2004 Feb 20 | 2004 Sep 2 |
| WO04037999 | A34 AND A33-LIKE 3 DNA, PROTEINS, ANTIBODIES THERETO AND METHODS OF TREATMENT USING SAME | SCANLAN M;RITTER G;OLD L;JUNGBLUTH A; | LUDWIG INSTITUTE FOR CANCER RESEARCH; | Polynucleotide molecules and polypeptide molecules A34 and A33-like 3 are described, as well as antibodies to polypeptide molecules A34 and A33-like 3. Also described are methods of detecting cancers expressing these polypeptides, and methods and kits for diagnosing said cancers, and methods of inhibiting effects of a cancer in a patient | 2003 Oct 23 | 2004 May 6 |
| WO04037987 | SECRETED PROTEINS | BAUGHN M;BECHA S;BHATIA U;BLAKE J;BURRILL J;CHAWLA N;CHIEN D;ELLIOTT V;EMERLING B;FAVERO K;HAFALIA A;HARMSSEN B;HO A;ISON C;KHARE R;LEE S;LEE SY;LU DA;MARQUIS J;MURAGE J;NGUYEN D;RAMKUMAR J;RICHARDSON T;SWARNAKAR A;TANG T;TRAN U;WANG J;YUE H;ZHENG W; | INCYTE CORPORATION; | Various embodiments of the invention provide human secreted proteins (SECP) and polynucleotides which identify and encode SECP. Embodiments of the invention also provide expression vectors, host cells, antibodies, agonists, and antagonists. Other embodiments provide methods for diagnosing, treating, or preventing disorders associated with aberrant expression of SECP | 2003 Oct 22 | 2004 May 6 |
| WO04099240 | PEPTIDES AND MIXTURES THEREOF FOR USE IN THE DETECTION OF SEVERE ACUTE RESPIRATORY SYNDROME-ASSOCIATED CORONAVIRUS (SARS) | HOUDE M;LACROIX JM; | ADALTIS INC.; | The present invention relates to novel peptides and mixtures thereof useful for detecting Severe Acute Respiratory Syndrome-associated coronavirus (SARS-CoV) infections in humans and animals. Therefore, the present invention provides SARS-CoV diagnostic methods and kits | 2004 May 5 | 2004 Nov 18 |
| WO04092360 | THE SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS | RAPPUOLI R;MASIGNANI V;STADLER K;GREGERSEN JP;CHIEN D;HAN J;POLO J;WEINER A;HOUGHTON M;SONG H;SEO M;DONNELLY J;KLENK H;VALIANTE N; | CHIRON CORPORATION; | An outbreak of a virulent respiratory virus, now known as Severe Acute Respiratory Syndrome (SARS), was identified in Hong Kong, China and a growing number of countries around the world in 2003. The invention relates to nucleic acids and proteins from the SARS coronavirus. These nucleic acids and proteins can be used in the preparation and manufacture of vaccine formulations, diagnostic reagents, kits, etc. The invention also provides methods for treating SARS by administering small molecule antiviral compounds, as well as methods of identifying potent small molecules for the treatment of SARS | 2004 Apr 9 | 2004 Oct 28 |
| WO04058957 | CANINE CYP1A2 SEQUENCES | GU Y; | UPJOHN COMPANY; | The present invention provides a cDNA encoding a heretofore unknown polypeptide termed canine CYP1A2; the canine CYP1A2 polypeptide encoded by the gene; antibodies to the polypeptide; and methods of making and using all of the foregoing | 2003 Dec 19 | 2004 Jul 15 |
| WO04056851 | PEPTIDES MIMICKING VIBRIO CHOLERAE O139 CAPSULAR POLYSACCHARIDE AND THEIR USE TO ELICIT PROTECTIVE IMMUNE RESPONSE | FELICI FRAN;WEINTRAUB ANDR; | FELICI F;WEINTRAUB A; | The present invention discloses peptide mimics against the capsular polysaccharide of V. cholerae O139, their antigenic portions, their equivalents, MAP construct. These peptides can be conjugated with another substance useful in immunization and used for the preparation of a medicament for the prophylaxis of cholera. Also disclosed are processes for their preparation, pharmaceutical compositions comprising them, in particular a vaccine and a diagnostic kit | 2003 Jul 31 | 2004 Jul 8 |
| WO04056863 | SPLICE VARIANT | FAGAN R;PHELPS C;RODRIGUES T;POWER C;DE TIANI M; | ARES TRADING SA; | This invention relates to a novel protein, termed INSP105, herein identified as a novel splice variant of human placental growth hormone and to the use of this protein and nucleic acid sequences from the encoding genes in the diagnosis, prevention and treatment of disease | 2003 Dec 19 | 2004 Jul 8 |
| WO04056866 | ASTHMA SUSCEPTIBILITY LOCUS | LAITINEN T;KERE J;LAITINEN L;POLVI A;MAKELA S;VENDELIN J;PULKKINEN V;SALMIKANGAS P; | GENEOS OY; | The present invention describes a susceptibility locus which is functionally related to asthma. The locus maps within human chromosome 7p15-p14. The invention also describes a novel human gene, GPRA. The invention provides diagnostic methods and materials for analysing allelic variation in said locus and the GPRA gene. The invention also provides polypeptides encoded by GPRA gene and antibodies binding to said polypeptides. The invention further provides pharmaceutical compositions for the treatment of asthma, other IgE-mediated disease, chronic obstructive pulmonary disease or cancer | 2003 Dec 19 | 2004 Jul 8 |
| WO04050852 | RECOMBINANT POLYPEPTIDES FOR DIAGNOSING INFECTION WITH TRYPANOSOMA CRUZI | KIRCHHOFF L;OTSU KEIK; | KIRCHHOFF L;OTSU K; | Recombinant polypeptides are disclosed that are useful for diagnosing American trypanosomiasis, or Chagas disease, a disease caused by the infectious agent Trypanosoma cruzi. Preferably, DNA sequences encoding the recombinant proteins are placed in plasmid vectors to be expressed in an organism | 2003 Dec 4 | 2004 Jun 17 |
| WO04050849 | RECOMBINANT IMMUNOTOXIN AND USE IN TREATING TUMORS | PASTAN I;ONDA M;CHEUNG NK; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA arbTSDOHAHS;MEMORIAL SLOAN-KETTERING CANCER CENTER; | Immunotoxins are disclosed that include a toxin, a variable region of a heavy chain of a monoclonal antibody that binds the antigen specifically bound by monoclonal antibody 8H9, and a variable region of a light chain of the monoclonal antibody that binds the antigen specifically bound by monoclonal antibody 8H9 and effector molecule. These immunotoxins include scFv and dsFv of monoclonal antibody 8H9. The immunotoxins are of use for the treatment of tumors | 2003 Dec 1 | 2004 Jun 17 |
| WO04018577 | BASE PAINTS CONTAINING FATTY ACID-MODIFIED EPOXY ESTERS AND/OR FATTY ACID-MODIFIED ALKYD RESINS, METHODS FOR THE PRODUCTION THEREOF AND THEIR USE | L?R I;LAVALAYE J; | BASF COATINGS AG; | The invention relates to base paints containing one or more water-soluble fatty acid-modified epoxy esters and/or one or more fatty acid-modified alkyd resins, to methods for the production thereof and to their use | 2003 Jun 28 | 2004 Mar 4 |
| WO04018514 | POLYPEPTIDES OF NONTYPEABLE HAEMOPHILUS INFLUENZAE AND CORRESPONDING DNA FRAGMENTS | CHARLAND N;MARTIN D;HAMEL J;BRODEUR B;HAMELIN Mv; | SHIRE BIOCHEM INC.; | The present invention relates to polypeptides of H. influenzae which may be useful for prophylaxis, diagnostic and/or therapy purposes | 2003 Aug 22 | 2004 Mar 4 |
| WO04083448 | MOLECULAR DIFFERENCES BETWEEN SPECIES OF THE M.TUBERCULOSIS COMPLEX | BEHR M;SMALL P;WILSON M;SCHOOLNIK G;AAGAARD C;ROSENKRANDS I;WELDINGH K;ANDERSON P; | THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY;STATENS S; | Specific genetic deletion are identified in mycobacteria isolates, including variations in the M. tuberculosis genome sequence between isolates, and numerous deletion present in BCG as compared to M. tbThe genetic markers can be used for diagnosis of M. tb. infection. One or more antigens provided from the genetic markers can be used in diagnostic assays, e.g. a serological assay | 2004 Mar 11 | 2004 Sep 30 |
| WO04067560 | NOVEL HERPES SIMPLEX VP16 PROTEIN BINDING POLYPEPTIDES | MEISTERERNST M;MITTLER G;SCHABERG U;ST?LER T; | GSF - FORSCHUNGSZENTRUM F? UMWELT UND GESUNDHEIT G; | The present invention relates to novel polypeptides capable of binding to Herpes simplex protein VP16 domain H1, and isolated polynucleotides encoding these polypeptides. Also provided are vectors, host cells, antibodies, and recombinant methods for producing these polypeptides. The invention further relates to diagnostic methods and therapeutic methods useful for treating Herpes simplex, EBV or Karposi Sarcoma Herpes Virus infections and disorders related to such infections | 2004 Jan 27 | 2004 Aug 12 |
| WO04069163 | CROSS-PROTECTIVE EPITOPES OF MORAXELLA CATARRHALIS AND METHODS OF USE THEREOF | LIU DF;MCMICHAEL J;BAKER S;FLETCHER L; | WYETH HOLDINGS CORPORATION; | The present invention broadly relates to immunogenic compositions for administering to a host susceptible to Moraxella catarrhalis infection. More particularly, the invention is directed to the identification of cross-reactive epitope sequences of the CopB protein of Moraxella catarrhalis | 2004 Jan 27 | 2004 Aug 19 |
| WO04061075 | TARGET RECOGNIZING BINDING AGENTS | QUIRK S; | KIMBERLY-CLARK WORLDWIDE I; | The invention is directed to binding agents having binding loops and a stable beta barrel conformation. The binding loops of these agents can easily be altered so that the binding agent can bind any selected target molecule. A variety of methods for generating binding agents with different binding loops are also provided | 2003 Oct 9 | 2004 Jul 22 |
| WO04045392 | DIAGNOSTIC METHOD FOR CELIAC SPRUE | KHOSLA C;SHAN L; | THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY; | Detection of toxic gluten oligopeptides refractory to digestion and antibodies and T cells responsive thereto can be used to diagnose Celiac Sprue | 2003 Nov 20 | 2004 Jun 3 |
| WO04048575 | STREPTOCOCCUS PNEUMONIAE POLYPEPTIDES | HAMEL J;CHARLAND N;MARTIN D;BRODEUR B;BLAIS N;PINEAU I;LABBA S; | SHIRE BIOCHEM INC.; | Streptococcus polypeptides and polynucleotides encoding them, antigens, epitopes, antibodies directed to these epitopes, which may be used to prevent, diagnose and/or treat Streptococcus pneumoniae infections in mammals, such as humans are disclosed | 2003 Nov 26 | 2004 Jun 10 |
| WO04042000 | 157 HUMAN SECRETED PROTEINS | ROSEN C;RUBEN S;OLSEN H;BAKER K;FISCELLA M;WEI P;BIRSE C;KOMATSOULIS G;CHOI G;MOORE P;GUPTA R;SHI Y; | HUMAN GENOME SCIENCES I; | The present invention relates to human secreted polypeptides, and isolated nucleic acid molecules encoding said polypeptides, useful for diagnosing and treating diseases, disorders, and/or conditions related to said human secreted proteins. Antibodies that bind these polypeptides are also encompassed by the present invention. Also encompassed by the invention are vectors, host cells, and recombinant and synthetic methods for producing said polynucleotides, polypeptides, and/or antibodies. The invention further encompasses screening methods for identifying agonists and antagonists of polynucleotides and polypeptides of the invention. The present invention further encompasses methods and compositions for inhibiting or enhancing the production and function of the polypeptides of the present invention | 2003 May 16 | 2004 May 21 |
| WO04029083 | HYPOALLERGENIC ALLERGY VACCINES BASED ON THE TIMOTHY GRASS POLLEN ALLERGEN PHL P 7 | WESTRITSCHNIG K;FOCKE M;TWARDOSZ A;VALENT P;VERDINO P;KELLER W;KRAFT D;VALENTA R; | BIOMAY PRODUKTIONS-UND HANDELS-AKTIENGESELLSCHAFT; | The present invention pertains to polypeptides derived from the timothy grass pollen allergen Phl p 7. The polypeptides display reduced allergenic activity and are useful as allergy vaccines for treatment of sensitized allergic patients and for prophylactic vaccination | 2003 Sep 25 | 2004 Apr 8 |
| WO04022097 | METHODS OF PREVENTING OR TREATING CELL MALIGNANCIES BY ADMINISTERING CD2 ANTAGONISTS | DINGIVAN C;WALDMANN T; | MEDIMMUNE I;NATIONAL CANCER INSTITUTE; | The present invention encompasses the use of a CD2 antagonist, preferably MEDI-507, an analog, derivative or an antigen-binding fragment thereof as a single agent therapy for the prevention, treatment, management, or amelioration of cancer, particularly a T-cell malignancy, or one or more symptoms thereof. The present invention also encompasses the use of a CD2 antagonist, preferably MEDI-507, an analog, derivative of an antigen-binding fragment thereof in combination with other cancer therapies. The present invention provides pharmaceutical compositions comprising a CD2 antagonist, preferably MEDI-507, an analog, derivative or an antigen-binding fragment thereof in amounts effective to prevent, treat, manage, or ameliorate cancer, particularly a T-cell malignancy, or one or more symptoms thereof | 2003 Sep 5 | 2004 Mar 18 |
| WO04022092 | ADJUVANTS | SIRARD JC;KRAEHENBUHL JP; | BTG INTERNATIONAL LIMITED; | A method is provided for inducing the adaptive immune response of a patient to an antigen comprising administering to the patient an effective amount of a flagellin protein or peptide fragment thereof to induce an adaptive immune response to said antigen | 2003 Sep 3 | 2004 Mar 18 |
| WO04003211 | BISPECIFIC ANTIBODIES THAT BIND TO VEGF RECEPTORS | ZHU Z; | IMCLONE SYSTEMS INCORPORATED; | The present invention is directed to production of antigen-binding proteins that bind specifically to an extracellular domains of two different VEGF receptors. The bispecific antigen-binding proteins block activation of the VEGF receptors and are used to reduce or inhibit VEGF-induced cellular functions such as mitogenesis of vascular endothelial cells and migration of leukemia cells. The antigen-binding proteins of the present invention can be monovalent or multivalent, have antigen-binding sites consisting of immunoglobulin heavy chain and light chain variable domains and may further include immunoglobulin constant domains | 2002 Dec 24 | 2004 Jan 8 |
| WO04048402 | A HEPATITIS C VIRUS CODON OPTIMIZED NON-STRUCTURAL NS3/4A FUSION GENE | SALLBERG M; | TRIPEP AB; | Aspects of the present invention relate to the creation of a codon-optimized hepatitis C virus (HCV) NS3/4A gene. Embodiments include said NS3/4A gene, fragments of said gene, HCV peptides encoded by said nucleic acids, nucleic acids encoding said HCV peptides, antibodies directed to said peptides, compositions containing said nucleic acids and peptides, as well as methods of making and using the aforementioned compositions including, but not limited to, diagnostics and medicaments for the treatment and prevention of HCV infection | 2003 Nov 25 | 2004 Jun 10 |
| WO04106886 | METHODS FOR DETECTING B. ANTHRACIS INFECTION | VALKIRS G;BUECHLER K; | BIOSITE INCORPORATED; | Detecting an anti-Bacillus anthracis antibody present in a biological sample comprises contacting a biological sample from an animal with an affinity agent comprising an epitope recognized by a first antibody that specifically binds to a sequence comprising 785 aino acids fully defined in the specification, where the affinity agent forms a forst complex with the anti-B. anthracis antibody if it is presint in the sample, and detecting the presence or absence of the first complex, the presence of such indicates the presence of antibodies to B. anthracis in the sample. | 2003 May 27 | 2004 Dec 9 |
| WO05014627 | RECOMBINANT DENGUE MULTI EPITOPE PROTEINS AS DIAGNOSTIC INTERMEDIATES | KHANNA N;ANANDA RAO R;JANA A; |
INTERNATIONAL CENTRE FOR GENETIC ENGINEERING AND
BIOTECHNOLOGY; DEVELOPMENT ORG; |
Novel recombinant protein antigens for use in the diagnosis of dengue are discclosed. These are prepared by assembling key immunodominant linear dengue-specific epitopes, chosen on the basis of pepscan analysis, phage display and computer predictions. One of these developed to specifically detect dengue-specific IgM and the other to detect IgG. These novelrecombinant dengue multiepitope proteins were expressed in E. coil, purified in a single step and used as capture antigens in ELISA. The ELISA results, using a large panel of suspected dengue patient sera, were in excellent agreement with those obtained using the commercially available Dengue Duo IgM and IgG Rapid strip test (PanBio). Similarly, tests were carried out using a rapid strip test | 2004 Aug 9 | 2005 Feb 17 |
| WO05023837 | EBOLA PEPTIDES AND IMMUNOGENIC COMPOSITIONS CONTAINING SAME | HART M;WILSON J;OLINGER G;BAILEY M; | UNITED STATES ARMY MEDICAL RESEARCH INSTITUTE OF INFECTIOUS DISEASES DEPARTMENT OF THE ARMY; | Using CTL epitopes to the Ebola GP, NP, VP24, VP30, VP35 and VP40 virion proteins, a method and composition for use in inducing an immune response which is protective against infection with Ebola virus is described | 2004 Mar 9 | 2005 Mar 17 |
| WO05037855 | T CELL EPITOPES USEFUL IN A YERSINIA PESTIS VACCINE AND AS DIAGNOSTIC TOOLS AND METHODS FOR IDENTIFYING SAME | LUND O;LUNDEGAARD C;NIELSEN M;WORNING P;DEANS R;BUUS Sr;BRUNAK Sr; | PECOS LABS I; | In a first aspect the present invention consists of T cell epitopes in the Yersinia pestis genome. More specifically there is provided 1,000 linear peptide epitopes from the Y. pestis genome. In a second aspect, the invention also consists of variants of these sequences. In a third aspect, this invention consists of a method to predict these sequences from genome data and to validate the predictions experimentally. In a fourth aspect, the present invention provides compositions including these epitopes for use in a vaccine and to induce a T cell response in a subject, or as a diagnostic tool | 2004 Oct 15 | 2005 Apr 28 |
| WO05042698 | T CELL EPITOPES USEFUL IN A HEPATITIS C VIRUS VACCINE AND AS DIAGNOSTIC TOOLS AND METHODS FOR IDENTIFYING SAME | LUND O;LUNDEGAARD C;NIELSEN M;WORNING P;DEANS R;BUUS Sr;BRUNAK Sr; | PECOS LABS I; | In a first aspect the present invention consists of T cell epitopes in the Hepatitis C virus genome. More specifically there is provided 429 linear peptide epitopes from the Hepatitis C Virus genome. In a second aspect the invention also consists of variants of these sequences. In a third aspect this invention consists of a method to predict these sequences from genome data and to validate the predictions experimentally. Ina fourth aspect the present invention provides compositions including these epitopes for use in a vaccine and to induce a T cell response in a subject, or as a diagnostic tool. Figure 2 shows a plot of the measured versus the predicted binding affinity score for four different prediction methods (1) Rammensee matrix method, (b) Hidden Markov model trained on sequences in the Rammensee dataset, (c) Neural network trained with sparse sequence encoding, and (d) The Comb-II neural network method | 2004 Oct 15 | 2005 May 12 |
| WO05047309 | PROPHYLACTIC AND THERAPEUTIC MONOCLONAL ANTIBODIES | CHANH T;ANDREWS G;ADAMOVICZ J;POWELL B; | U.S.ARMY MEDICAL RESEARCH INSTITUTE OF INFECTIOUS DISEASES; | In this application are described monoclonal antibodies which specifically recognize V antigen of Y. pestis and epitopes recognized by these monoclonal antibodies. Also provided are mixtures of antibodies of the present invention, as well as methods of using individual antibodies or mixtures thereof for the detection, prevention, and/or therapeutical treatment of plague infections in vitro and in vivo | 2004 Nov 12 | 2005 May 26 |
| WO05077412 | COMPOSITIONS AND METHODS OF USE OF W-PEPTIDES | PREMACK B;SCHALL T; | CHEMOCENTRYX; | The present invention relates to compositions and methods to modulating immune responses, such as those elicited by vaccination with W peptides. The compositions and methods are useful for, among other things, vaccine formulation for therapeutic and prophylactic vaccination (immunization) and for production of useful antibodies (e.g., monoclonal antibodies, for therapeutic or diagnostic use) | 2005 Jan 25 | 2005 Aug 25 |
| WO05081749 | NEUTRALIZING HUMAN ANTIBODIES TO ANTHRAXTOXIN | MORROW P;KANG A;WANG F;JIANG I;SAWADA-HIRAI R;SCHOLZ W; | AVANIR PHARMACEUTICALS I; MORROW J; | A highly efficient method for generating human antibodies using recall technology is provided. In one aspect, human antibodies which are specific to the anthrax toxin are provided. In one aspect, human peripheral blood cells that have been pre-exposed to anthrax toxin are used in the SCID mouse model. This method results in high human antibody titers which are primarily of the IgG isotype and which contain antibodies of high specificity and affinity to desired antigens. The antibodies generated by this method can be used therapeutically and prophylactically for preventing or treating mammals exposed to anthrax. Thus, in one embodiment, a prophylactic or therapeutic agent used to counter the effects of anthrax toxin, released as a mechanism of bioterrorism, is provided. In one embodiment, a formulation and method for preventing and/or treating anthrax infection comprising a binding agent that prevents the assembly of the PA63 heptamer is also provided. Methods for diagnosis and methods to determine anthrax contamination are also described | 2005 Jan 21 | 2005 Sep 9 |
| WO05086637 | ANTHRAX ANTIGENS AND METHODS OF USE | WIMER-MACKIN S; | LIGOCYTE PHARMACEUTICALS I; | Anthrax antigens are provided that find use as immunogens and vaccines | 2005 Feb 11 | 2005 Sep 22 |
| WO05087800 | ANTI-OBESE IMMUNOGENIC HYBRID POLYPEPTIDES AND ANTI-OBESE VACCINE COMPOSITION COMPRISING THE SAME | KIM HJ; | SJ BIOMED INC.; | Disclosed is an immunogenic hybrid polypeptide comprising a mimetic peptide of a B cell epitope of apolipoprotein B-100 and a helper T cell epitope, the mimetic peptide being fused at its C-terminus to an N-terminus of the helper T cell epitope. Also disclosed is a vaccine composition for preventing or treating obesity comprising the polypeptide | 2005 Mar 18 | 2005 Sep 22 |
| WO05118626 | PEPTIDES FOR INDUCING A CTL AND/OR HTL RESPONSE TO HEPATITIS C VIRUS | DEPLA E;BUYSE MA;LASTERS I;DESMET J;MAERTENS G;BAKER D;CHESNUT RW;NEWMAN M;SETTE A;SIDNEY J;SOUTHWOOD S; | INNOGENETICS NV;IDM PHARMA INC.; | The present invention is directed to peptides, and nucleic acids encoding them, derived from the Hepatitis C Virus (HCV). The peptides are those which elicit a CTL and/or HTL response in a host. The invention is also directed to compositions and vaccines for prevention and treatment of HCV infection and diagnostic methods for detection of HCV exposure in patients | 2005 May 30 | 2005 Dec 15 |
| WO05120567 | HUMAN ANTHRAX TOXIN NEUTRALIZING MONOCLONAL ANTIBODIES AND METHODS OF USE THEREOF | GROEN H;COOL-KEBBEDIES C;SLOPSEMA K;WESTRA H; | IQ CORPORATION; | The invention fully humanized monoclonal antibodies that neutralize Bacillus anthracis. Also provided are methods of treating or preventing a Bacillus anthracis infection. The invention also provides methods of passive vaccination of a subject against Bacillus anthracis | 2005 Mar 3 | 2005 Dec 22 |
| WO05124351 | A SENSITIVE ANTIBODY-BASED METHOD FOR DETECTING CRYPTOSPORIDIUM PARVUM OOCYSTS IN WATER | JENKINS M;KNIEL K; | THE UNITED STATES OF AMERICA arbTSOA; | A viral symbiont (CPV) of Cryptosporidium parvum and Cryptosporidium hominis sporozoites has been characterized and a CPV capsid protein, CPV40, has been identified as a target for sensitive detection of C. parvum.Recombinant CPV40 was produced in E. coli, purified by affinity chromatography, and used to prepare polyclonal rabbit sera specific for the viral capsid protein. Anti-rCPV40 recognized a 40 kDa and a 30 kDa protein in C. parvum oocysts and appeared to localize to the apical end of the parasite. Anti-rCPV40 serum was capable of detecting as few as one C. parvum or C.hominisoocyst in a dot blot assay, the sensitivity being at least 1000-fold greater than sera reactive with total native C. parvum protein or specific for the 41 kDa C. parvum oocyst surface antigen. Water samples were seeded with C parvum oocysts and incubated at 4, 20, or 25 ℃ for greater than 3 months to determine if CPV levels were correlated with oocyst infectivity and viral particle presence. While sporozoite infectivity declined by more than 75% after 1 month at 25 ℃, the CPV signal was similar to that of control samples at 4 ℃. By three months at 20 ℃, the C. parvumoocysts were found to be non-infectious, but retained a high CPV signal. CPV is an excellent target for sensitive detection of C. parvum and C. hominis oocysts in water, but may persist for an indefinite time after oocysts become non-infectious | 2005 May 31 | 2005 Dec 29 |
| WO06004362 | SUPERTYPE EPITOPES, OLIGONUCLEOTIDES CODING THE SAME WHICH INDUCE EFFECTIVE CTL RESPONSE AGAINST HCV AND THE USE THEREOF | HWANG YK;KIM NK;PARK JM;LIM O;PARK M; | MOGAM BIOTECHNOLOGY RESEARCH INSTITUTE; | The present invention relates to a supertype epitope which effectively induce a cell-mediated immune response and its use, specifically, a supertype epitope which effectively induce the cytotoxic T lymphocytes specific to HCV and come from conservative region of a HCV polyprotein, an expression vector comprising the oligonucleotide coding the said supertype epitope, a vaccine composition comprising the said supertype epitope or the said expression vector and its use for treatment of hepatitis C. The HCV supertype epitope of the present can be applied to various individuals because it binds to various HLA molecule and can induce antigen-specific immune response, be used to develop therapeutics for hepatitis C by virus hepatitis C and the vaccines for a liver disease related to that as a strong and effective tool, the expression vector comprising the oligonucleotide coding a HCV supertype epitope and the DNA vaccine comprising it can be used as a strong and effective tool for immune response suppressed hepatitis and liver disease related to that | 2005 Jul 4 | 2006 Jan 12 |
| WO06009862 | AMEBIASIS SUBUNIT VACCINE | RAVDIN J;ABD ALLA M; | REGENTS OF THE UNIVERSITY OF MINNESOTA; | Entamoeba L'invention concerne des peptides de la sous-unitq LC3 de <i>Entamoeba histolytica</i>, ainsi des polynuclqotides codant pour ces peptides, le peptide de la sous-unitq LC3 est prqsent a raison d'une dose suffisante pour induire la production d'anticorps IgA anti-lectine dirigqs contre <i>Entamoeba histolytica ou E. dispar</i> chez un primate. L'invention concerne qgalement des vaccins a base de peptides de la sous-unitq LC3 de <i> Entamoeba histolytica</i>, et des mqthodes d'utilisation de ces vaccins | 2005 Jun 16 | 2006 Jan 26 |
| WO06017206 | FLAVIVIRUS VACCINE | PANG X;GU X; | TENGEN BIOMEDICAL COMPANY; | Replicon virus-like particles can be used as flavivirus vaccines | 2005 Jul 11 | 2006 Feb 16 |
| WO06028634 | SITE SPECIFIC PEGYLATION OF BROADLY-NEUTRALIZING ANTIBODIES AGAINST HEPATITIS C VIRUS AND THEIR USE IN THE TREATMENT OF CHRONIC HCV INFECTIONS | RAMAKRISHNAN V; | RAMAKRISHNAN VIJA; | The present invention provides for the pegylation of therapeutic antibodies to treat HCV infections. More specifically, the invention relates to site-specific pegylation of E2 antibody fragments at specifically defined amino acid residue(s) that is optionally engineered away from the antigen binding sites. The pegylated-MAb derivatives show substantially improved pharmacokinetic and pharmacodynamic properties, and they are broadly-neutralizing against several HCV clinical isolates by selectively binding to broadly-conserved neutralization epitope(s) of HCV E2 glycoprotein | 2005 Aug 9 | 2006 Mar 16 |
| WO06031825 | HUMANIZED ANTIBODIES AGAINST WEST NILE VIRUS AND THERAPEUTIC AND PROPHYLACTIC USES THEREOF | JOHNSON L;HUANG L; | MACROGENICS I; | The present invention relates to compositions comprising humanized antibodies or fragments thereof that immunospecifically bind to one or more antigens of a flavivirus, particularly of West Nile Virus (WNV) and methods for preventing, treating or ameliorating symptoms associated with a flavivirus, particularly of West Nile Virus (WNV) infection utilizing said compositions. In particular, the present invention relates to methods for preventing, treating or ameliorating to a human subject an effective amount of one or more humanized antibodies or fragments thereof that immunospecifically bind to a WNV antigen. The present invention also relates to detectable or diagnostic compositions comprising humanized antibodies or fragments thereof that immunospecifically bind to a WNV antigen and methods for detecting or diagnosing WNV infection utilizing said compositions | 2005 Sep 13 | 2006 Mar 23 |
| WO06033768 | HCV MULTIPLE EPITOPE FUSION ANTIGENS WITH MODIFIED PROTEOLYTIC CLEAVAGE SITES AND USES THEREOF | CHIEN DY;COIT D;GEORGE-NASCIMENTO C;SANSAN L;MEDINA-SELBY A;TANDESKE L; | CHIRON CORPORATION; | Modified HCV multiple epitope fusion antigens (MEFAs) are described. The proteins include modified sequences such that proteolytic cleavage of the MEFAs by HCV NS3 protease is inhibited. HCV immunoassays including the modified MEFAs are also described | 2005 Aug 26 | 2006 Mar 30 |
| WO02094851 | PEPTIDE VACCINES AGAINST GROUP A STREPTOCOCCI | BEALL B;CARLONE G;SAMPSON J;ADES E; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA ABTSDOHHSCFDCAPTTO; | This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross- reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies. In still further aspects, the invention also relates to methods for using the peptides, compositions, vaccines, or antibodies and methods for tailoring vaccines | 2002 May 20 | 2002 Nov 28 |
| WO04106365 | MODULATORY MOTIFS FOR INDUCING TH1 OR TH2 IMMUNE RESPONSE | GUY B;KRELL T;SODOYER R; | AVENTIS PASTEUR I; | The present invention relates to techniques for inducing either a TH1 or TH2-type immune response. Specific motifs may be added or deleted from antigens, thus inducing either a TH1- or TH2-type immune response against the antigen | 2004 May 27 | 2004 Dec 9 |
| WO04108756 | SARS CORONAVIRUS PEPTIDES AND USES THEREOF | CAMPBELL W;JIA W;ZHOU Q; | PEGASUS PHARMACEUTICALS GROUP INC.; | Antibody-binding peptides encoded by portions of the genome of a virus that causes Severe Acute Respiratory Syndrome (SARS) are provided. The use of the peptides and arrays comprising the peptides in the diagnosis of SARS, to determine the stage of a SARS infection, or to identify individuals who have previously been infected with a virus that causes SARS are also provided. The peptides can also be used in the preparation of vaccines for the treatment or prophylaxis of SARS | 2004 Jun 9 | 2004 Dec 16 |
| WO04110349 | T CELL EPITOPES USEFUL IN A SEVERE ACUTE RESPIRATORY SYNDROME (SARS) VIRUS VACCINE AND AS DIAGNOSTIC TOOLS AND METHODS FOR IDENTIFYING SAME | NIELSEN M;LUND O;LUNDEGAARD C;WORNING P;BUUS S;BRUNAK S;JUSTESEN S;SYLVESTER-HVID C;RODER G;LAMBERTH K; | SIGA TECHNOLOGIES I; | In a first aspect the present invention consists of T cell epitopes in the Severe Acute Respiratory Syndrome (SARS) virus genome. More specifically there is provided 180 class I linear peptide epitopes and 200 class II linear epitopes from the SARS Virus genome. In a second aspect the invention also consists of variants of these sequences. In a third aspect this invention consists of a method to predict these sequences from genome data and to validate the predications experimentally. In a fourth aspect the present invention provides compositions including these epitopes for use in a vaccine and to induce a T cell response in a subject, or as a diagnostic tool | 2004 May 14 | 2004 Dec 23 |
| WO04111081 | ANTIGENIC PEPTIDES OF SARS CORONAVIRUS AND USES THEREOF | TER MEULEN J;GOUDSMIT J;SLOOTSTRA JW;TIMMERMAN P;PUIJK WC; | CRUCELL HOLLAND BV; | The present invention pertains to antigenic peptides of SARS-CoV and their use in diagnostic test methods and in the treatment of condition resulting from SARS-CoV. Furthermore, this invention provides antibodies capable of specifically recognizing the peptides of the invention. The antibodies can also advantageously be used in diagnostic test methods and in the treatment of condition resulting from SARS-CoV | 2004 Jun 14 | 2004 Dec 23 |
| WO05004910 | HCV VACCINES | BUSCHLE M;FRISCH Jr;KLADE C;LINGNAU K;ZAUNER W;ZETTLMEISSL G; | INTERCELL AG; | Disclosed is a Hepatitis C virus (HCV) vaccine comprising at least two epitopes, each from a different hotspot epitope, wherein a hotspot epitope is defined as an epitope containing peptide selected from the group consisting of KFPGGGQIVGGVYLLPRRGPRLGVRATRK, GYKVLVLNPSVAAT, AYAAQGYKVLVLNPSVAAT, DLMGYIP(A/L)VGAPL, GEVQVVSTATQSFLATCINGVCWTV, HMWNFISGIQYLAGLSTLPGNPA, VDYPYRLWHYPCT(V/I)N(F/Y)TIFK(V/I)RMYVGGVEHRL, AAWYELTPAETTVRLR, GQGWRLLAPITAYSQQTRGLLGCIV, IGLGKVLVDILAGYGAGVAGALVAFK, FTDNSSPPAVPQTFQV, LEDRDRSELSPLLLSTTEW, YLVAYQATVCARAQAPPPSWD, MSTNPKPQRKTKRNTNR, LINTNGSWHINRTALNCNDSL, TTILGIGTVLDQAET, FDS(S/V)VLCECYDAG(A/C)AWYE, ARLIVFPDLGVRVCEKMALY, AFCSAMYVGDLCGSV, GVLFGLAYFSMVGNW, VVCCSMSYTWTGALITPC, TRVPYFVRAQGLIRA and TTLLFNILGGWVAAQ | 2004 Jul 9 | 2005 Jan 20 |
| WO05012337 | ANTIGENIC PEPTIDES OF SARS CORONAVIRUS AND USES THEREOF | TER MEULEN J;GOUDSMIT J;SLOOTSTRA JW;TIMMERMAN P;DE KRUIF CA;VAN DEN BRINK EN; | CRUCELL HOLLAND BV; | The present invention pertains to antigenic peptides of SARS-CoV and their use in diagnostic test methods and in the treatment of condition resulting from SARS-CoV. Furthermore, this invention provides antibodies capable of specifically recognizing the peptides of the invention. The antibodies can also advantageously be used in diagnostic test methods and in the treatment of condition resulting from SARS-CoV | 2004 Jul 15 | 2005 Feb 10 |
| WO05012338 | ANTIGENIC PEPTIDES OF SARS CORONAVIRUS AND USES THEREOF | TER MEULEN J;GOUDSMIT J;SLOOTSTRA JW;TIMMERMAN P; | CRUCELL HOLLAND BV; | The present invention pertains to antigenic peptides of SARS-CoV and their use in diagnostic test methods and in the treatment of condition resulting from SARS-CoV. Furthermore, this invention provides antibodies capable of specifically recognizing the peptides of the invention. The antibodies can also advantageously be used in diagnostic test methods and in the treatment of condition resulting from SARS-CoV | 2004 Jul 20 | 2005 Feb 10 |
| WO05012343 | BABESIA VACCINES | CARCY BPD;GORENFLOT AF;SCHETTERS TPM;CIBRELUS PL;MOUBRI K;DEPOIX D; | AKZO NOBEL NV; | The invention relates to Babesia proteins of a 28kDa protein family and to immunogenic fragments of such proteins, to nucleic acids encoding such proteins or fragments, to cDNA fragments, recombinant DNA molecules, live recombinant carriers, or host cells comprising such nucleic acids, to vaccines, to methods for the preparation of such vaccines, to the use of such proteins or fragments for the prophylactic or therapeutic treatment of an infection or its clinical signs caused by an organism of the family Babesiidae, and to diagnostic tests for detection of nucleic acids, antibodies or antigens of an organism of the family Babesiidae | 2004 Jul 12 | 2005 Feb 10 |
| WO05016132 | DIAGNOSTICS FOR SARS VIRUS | KWANG J;LING A;OOI E;CHNG H; | TEMASEK LIFE SCIENCES LABO; | This invention relates to Severe Acute Respiratory Syndrome associated coronavirus (SARS virus) isolated and recombinant proteins, in particular the nucleocapsid (N) protein and spike (S) protein, as well as fragments thereof and their use in the diagnosis, treatment and prevention of Severe Acute Respiratory Syndrome (SARS). The proteins and fragments carry epitopes that are specific for the SARS virus. Thus, detection methods based on these proteins or fragments as well as the monoclonal antibodies against these proteins or fragments are specific for the SARS virus | 2004 Feb 4 | 2005 Feb 24 |
| WO05016238 | SEVERE ACUTE RESPIRATORY SYNDROME | HAYNES B;LIAO HX; | DUKE UNIVERSITY; | The present invention relates, in general, to severe acute respiratory syndrome and, in particular, to a method of generating neutralizing antibodies to the virus. The invention further relates to methods of detecting the presence of the virus and to methods of treating infected individuals | 2004 May 10 | 2005 Feb 24 |
| WO05016383 | COMPOSITIONS AND VACCINES CONTAINING ANTIGEN(S) OF CRYPTOSPORIDIUM PARVUM AND OF ANOTHER PATHOGEN | DAVID F;MILWARD F; | MERIAL LIMITED; | Combination compositions including C. parvum antigen(s) or epitope(s) of interest with at least one other antigen or epitope of interest from a pathogen that causes enteric infection and/or symptoms and/or recombinant(s) and/or vector(s) and/or plasmid(s) expressing such antigen(s) or epitope(s) of interest and administration of such compositions such as to pregnant mammals and/or newborn or young mammals, for instance, pregnant cows and/or calves such as within the first month of birth, are disclosed and claimed | 2004 Aug 12 | 2005 Feb 24 |
| WO05019246 | CORONAVIRUS VACCINES, THERAPEUTICS AND DIAGNOSTICS | NG A;MONDRY A;PING L;PENG C;CHITRE M; | EXPLOIT TECHNOLOGIES PTE LTD;IP ORGANISERS PTY LTD; | The present invention provides peptides useful in the prevention and diagnosis of coronavirus infection. The peptides may be used as a component of a vaccine as it is contemplated they will elicit a protective immune response. It is further contemplated that the peptides are useful for diagnosis of a coronavirus infection, and especially in respect of SARS infection | 2004 Aug 23 | 2005 Mar 3 |
| WO05035714 | VACCINES FOR CANCER, AUTOIMMUNE DISEASE AND INFECTIONS | MOLLDREM J; | BOARD OF REGENTS TUOTS; | The present invention provides tumor-associated HLA-restricted antigens, and in particular HLA-A2 restricted antigens, as vaccines for treating or preventing cancers in a patient. In specific aspects, neutrophil elastase peptides other than PR1, cyclin E1 peptides, cyclin D peptides, or cyclin E2 peptides are provided. Such peptides can be used to elicit specific CTLs that preferentially attack tumor cells. The present invention also provides HLA-restricted antigens as vaccines for treating or preventing autoimmune diseases or conditions, transplant rejection or vasculitis in a patient. In particular aspects, there is provided Pr3, a myeloid tissue-restricted protein and a HLA-A2.1-restricted self-peptide, PRl, derived from Pr3, which can be used to elicit PR1-specific CTLs. The present invention also provides a HLA-restricted-peptide myeloperoxidases-based methods | 2004 Aug 26 | 2005 Apr 21 |
| WO05037233 | LISTERIA-BASED EPHA2 VACCINES | KINCH M;KIENER P;BRUCKHEIMER E;DUBENSKY T;COOK D; | MEDIMMUNE I;CERUS CORPORATION; | The present invention relates to methods and compositions designed for the treatment, management, or prevention of cancer, particularly metastatic cancer and cancers of T cell origin, and hyperproliferative diseases involving EphA2-expressing cells. The methods of the invention entail the use of a Listeria-based EphA2 vaccine. The invention also provides pharmaceutical compositions comprising one or more Listeria-based vaccines of the invention either alone in combination with one or more other agents useful for cancer therapy. In certain aspects of the invention, the method entail eliciting both CD4+ and CD8+ T-cell responses against EphA2 and/or EphA2-expressing cells | 2004 Oct 15 | 2005 Apr 28 |
| WO05047308 | PEPTIDE-BASED DIAGNOSTIC REAGENTS FOR SARS | WANG C;FANG X;CHANG T;LIU S;LYNN S;SIA C; | UNITED BIOMEDICAL I; | The present invention is directed to antigenic peptides and peptide compositions selected from the Membrane glycoprotein (M), the Spike glycoprotein (S), and the Nucleocapsid (N) protein antigens of the SARS coronavirus (SCoV). The present invention is also directed to methods of use of the peptides of the invention, e.g., for the detection of SARS-associated antibodies. Detection methods include enzyme-linked immunosorbent assay (ELISA) or other immunoassay procedures | 2004 Nov 12 | 2005 May 26 |
| WO05060520 | ANTIBODIES AGAINST SARS-CoV AND METHODS OF USE THEREOF | MARASCO W;SUI J; | DANA-FARBER CANCER INSTITUTE I; | The invention provides scFv antibodies and monoclonal antibodies that neutralize SARS-CoV. Also provided are methods of treating and/or preventing a coronavirus-related disease or disorder such as SARS. The invention also provides methods of vaccinating a patient against SARS-CoV. Also provided are methods of diagnosing coronavirus-related or disorders and methods of detecting the presence of a coronavirus in a sample. The invention additionally provides methods of screening for compounds that modulate the binding of SARS-CoV and the SARS-CoV receptor ACE2 as well as for compounds useful to treat SARS-CoV-related diseases or disorders | 2004 Nov 24 | 2005 Jul 7 |
| WO05081716 | DNA VACCINES TARGETING ANTIGENS OF THE SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS (SARS-CoV) | WU TC;HUNG CF;KIM TW; | THE JOHNS HOPKINS UNIVERSITY; | This invention provides compositions and methods for inducing and enhancing immune responses, particularly antigen-specific CD8+ T cell mediated responses, against antigens of the SARS coronavirus. These antigens include epitopes of the Membrane (M), Envelope (E), Spike (S) and Nucleocapsid (N) proteins of the virus. Such responses are induced using DNA constructs as an immunogens or vaccines, which encode chimeric polypeptides comprising endoplasmic reticulum chaperone polypeptides, such as human calreticulin (CRT) and an antigenic peptide or polypeptide. In particular, the invention provides compositions and methods for enhancing immune responses induced by polypeptides made in vivo by administered nucleic acid, such as naked DNA or expression vectors, encoding the chimeric molecules. Such enhanced immunity, whether T cell mediated or antibody-mediated protects an infected subject from infection or spread of the SARS CoV in vivo | 2004 Nov 24 | 2005 Sep 9 |
| WO05089164 | INDUCING CELLULAR IMMUNE RESPONSES TO HUMAN PAPILLOMAVIRUS USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS |
Babe,LM.Baker,D.Chen, Y.Chesnut,R.Deyoung, LM.Huang,MTF.Mothe,B, Newman,MJ.Power, SD.Southwood,S. |
EPIMMUNE INC.;INNOGENETICS NV;CHESNUT R;NEWMAN M;MOTHE B;BAKER D;SOUTHWOOD S;BABE L;CHEN Y;DEYOUNG L;HUANG M;POWER S; | This invention uses our knowledge of the mechanisms by which antigen is recognized by T cells to identify and prepare human papillomavirus (HPV) epitopes, and to develop epitope-based vaccines directed towards HPV. More specifically, this application communicates our discovery of pharmaceutical compositions and methods of use in the prevention and treatment of HPV infection | 2005 Jan 3 | 2005 Sep 29 |
| WO9501442 | NUCLEOTIDE AND AMINO ACID SEQUENCES OF THE ENVELOPE 1 GENE OF 51 HEPATITIS C VIRUS ISOLATES AND THE USE OF REAGENTS DERIVED THEREFROM AS DIAGNOSTIC REAGENTS AND VACCINES | BUKH J;MILLER R;PURCELL R; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA rbTSDOHAHS; | The nucleotide and deduced amino acid sequences of 51 cDNAs are disclosed where each cDNA encodes the envelope 1 gene of an isolate of hepatitis C virus (HCV). The invention relates to the oligonucleotides, peptides and recombinant envelope 1 proteins derived from these sequences and their use in diagnostic methods and vaccines | 1994 Jun 28 | 1995 Jan 12 |
| WO006694 | COMPOUND AND METHOD FOR THE PREVENTION AND/OR THE TREATMENT OF ALLERGY | SAINT-REMY JM;JACQUEMIN M; | UCB SA; | The present invention is related to a compound for the prevention and/or the treatment of allergy consisting of: at least one allergen antigenic determinant which is recognised by a B cell or an antibody secreted by a B cell of a non-atopic individual to said allergen, and at least one antigenic determinant of an antigen different from said allergen which triggers T cell activation | 1999 Jul 20 | 2000 Feb 10 |
| WO0236146 | CANCER THERAPY | TAFURO S;MEIER UC;MCMICHAEL A;BELL J;LAYTON G;HUNTER M; | ISIS INNOVATION LIMITED; | The present invention relates to polynucleotides for use in cancer therapy. In particular, the invention provides a polynucleotide capable of expressing an epitope-beta 2m fusion protein; for use in the generation of cytotoxic T lymphocyte (CTL) responses against a tumour; and a polynucleotide capable of expressing an epitope-beta 2m fusion protein; for use in a method of restoring antigen presentation in the tumour of a host | 2001 Nov 1 | 2002 May 10 |
| WO03045128 | SYNTHETIC IMMUNOGENIC BUT NON-DEPOSIT-FORMING POLYPEPTIDES AND PEPTIDES HOMOLOGOUS TO AMYLOID beta, PRION PROTEIN, AMYLIN, alpha-SYNUCLEIN, OR POLYGLUTAMINE REPEATS FOR INDUCTION OF AN IMMUNE RESPONSE THERETO | FRANGIONE B;WISNIEWSKI T;SIGURDSSON E; | NEW YORK UNIVERSITY; | The present invention relates to immunogenic but non-depositing-forming polypeptides or peptides homologous to amyloid beta, prion, amylin or alpha-synuclein which can be used alone or conjugated to an immunostimulatory molecule in an immunizing composition for inducing an immune response to amyloid beta peptides and amyloid deposits, to prion protein and prion deposits, to amylin and amylin deposits, to alpha-synuclein and deposits containing alpha-synuclein, or to polyglutamine repeats and deposits of proteins containing polyglutamine repeats. Described are also antibodies directed against such peptides, their generation, and their use in methods of passive immunization to such peptides and deposits | 2002 Nov 21 | 2003 Jun 5 |
| WO03072607 | MONOCLONAL ANTIBODIES THAT ARE CROSS-REACTIVE AGAINST BACTERIAL COLLAGEN BINDING PROTEINS | SPEZIALE P;VISAI L;GIAMPIERO P; | UNIVERSIT?DEGLI STUDI DI PAVIA;BATES S; | Cross-reactive monoclonal antibodies are provided which are generated from peptides from Enterococcus faecalis, including the ACE40 and the ACE19 protein, and the CNA19 peptide from Staphylococcus aureus, and which can bind to the collagen-binding proteins from bacteria and from a variety of species including enterococcal bacteria, staphylococcal bacteria and streptococcal bacteria. These monoclonal antibodies may then be formed into suitable pharmaceutical compositions, and they are thus particularly effective in providing methods of treating or preventing bacterial infections from a wide range of bacterial species | 2003 Feb 21 | 2003 Sep 4 |
| WO03091437 | CHIMERIC CAMP FACTORS FOR VACCINATION AGAINST STREPTOCOCCUS INFECTION | POTTER A;PEREZ-CASAL J;FONTAINE M;SONG X; | UNIVERSITY OF SASKATCHEWAN; | The CAMP factor gene of Streptococcus uberis (S. uberis) is described, as well as the recombinant production of CAMP factor therefrom. Also disclosed are chimeric CAMP factor constructs, including CAMP factor epitopes from more than one bacterial species. The CAMP factors and chimeras including the same can be used in immunogenic compositions for the prevention and treatment of bacterial infections | 2003 Apr 24 | 2003 Nov 6 |
| WO05019828 | EPITOPE PROTECTION ASSAY AND METHOD FOR DETECTING PROTEIN CONFORMATIONS | CASHMAN NEIL;LEHTO MART; | CASHMAN N;LEHTO M; | The invention relates to an epitope protection assay for use in diagnosis, prognosis and therapeutic intervention in diseases, for example, involving polypeptide aggregation, such as prion infections. The methods of the invention first block accessible polypeptide target epitope with a blocking agent. After denaturation of the polypeptide, a detecting agent is used to detect protein with target epitope that was inaccessible during contact with the blocking agent | 2004 Aug 20 | 2005 Mar 3 |
| WO05121168 | HEPARIN BINDING PEPTIDE | BOCK E;BEREZIN V; | ENKAM PA; | The invention relates to new peptide fragments capable of stimulating neurite outgrowth, stimulating of cell survival, stimulating neural plasticity associated with memory and learning, and modulating cell motility. The biological activity of the peptide fragments is associated with their capability of binding and activating a neurotrophin receptor of the Trk family. The peptide fragments of the invention comprise an amino acid motif which is essential for binding and activating a neurotrophin receptor of the Trk family. The invention also concerns pharmaceutical compositions comprising the compounds and uses thereof for prevention and/or treatment of conditions and/or diseases, wherein neurotrophing, Tkr receptors and/or NCAM play an important role, and wherein stimulating of neurite outgrowth, cell survival, neural plasticity associated with memory and learning, and/or modulating cell motility is beneficial for treatment | 2005 Jun 10 | 2005 Dec 22 |
| WO8400687 | BROAD SPECTRUM INFLUENZA ANTISERA | GREEN N;ALEXANDER S; | RESEARCH FOUNDATION; | Antisera against synthetic peptides which neutralize influenza viruses of differing hemagglutinin subtypes, provide protection against infection by influenza virus and methods of preparing the same | 1983 Aug 23 | 1984 Mar 1 |
| WO8700179 | SYNTHETIC PEPTIDE-BASED ANTI-RABIES COMPOSITIONS AND METHODS | PATRICK J;HEINEMANN S;BOSS B;COWAN W; | THE SALK INSTITUTE FOR BIOLOGICAL STUDIES; | A sequence in the coat glycoprotein of rabies virus is identified as the molecular basis for an essential step in the pathogenesis of the virus, the binding of virus to acetylcholine receptor at neuromuscular junctions prior to virus uptake into peripheral nerves. Based on this discovery, synthetic peptide-based, anti-rabies vaccines are prepared. The active ingredient of such vaccines is a synthetic protein, which is a conjugate with an immunogenic carrier protein of a synthetic peptide with a sequence which includes a sequence which is substantially the same as a substantial portion of the sequence of the acetylocholine receptor-binding segment of the rabies virus coat protein. Anti-rabies antisera, and anti-rabies antibodies, are prepared by injecting a mammal with a synthetic protein of the invention in a manner that induces an immune response in the mammal against the synthetic protein. Hybridomas which secrete anti-rabies antibodies, which bind to specific epitopes on or near the acetycholine receptor binding segment on the rabies virus coat glycoprotein, are prepared with B cells immunized in vitro with a synthetic peptide or synthetic protein of the invention or taken from a mammal inoculated with such a peptide or protein. The anti-rabies vaccines of the invention avoid risks associated with currently available anti-rabies vaccines. The antisera and antibodies of the invention are useful therapeutically to induce passive anti-rabies immunity in a mammal that has been exposed to rabies virus. The antisera and antibodies are also useful for diagnosing whether a mammal is rabid and whether a mamma has been exposed to live rabies virus | 1986 Jul 3 | 1987 Jan 15 |
| WO8804932 | VACCINES AND DIAGNOSTIC ASSAYS FOR HAEMOPHILUS INFLUENZAE | DEICH R;ZLOTNICK G;GREEN B; | PRAXIS BIOLOGICS I; | Peptides and proteins related to an epitope comprising an outer membrane protein of Haemophilus influenzae. The peptides and proteins can be prepared by methods including novel and improved methods of purification from H. influenzae cultures, and by recombinant DNA and chemical synthetic techniques. Additionally, recombinant vectors containing nucleotide sequences encoding PBOMP-1 and PBOMP-2 related peptides and proteins are also described. Recombinant vectors include plasmid DNA and viral DNA such as human viruses, animal viruses, insect viruses and bacteriophages that direct the expression of the PBOMP-1 and PBOMP-2 related peptides and proteins in appropriate host cells. The peptides, proteins and viruses both ''live'' and ''inactivated'' are used as immunogens in vaccine formulations to protect againts H. influenzae infections. The peptides and proteins are also used as reagents in immunoassays as well as to prepare immunoglobulins for passive immunization. Use of the nucleotide sequences encoding the PBOMP related peptides and proteins in hybridization assays is also described | 1987 Dec 23 | 1988 Jul 14 |
| WO8910405 | CHIMERIC GLYCOPROTEINS CONTAINIG IMMUNOGENIC SEGMENTS OF HUMAN PARAINFLUENZA VIRUS TYPE 3 | WATHEN M; | THE UPJOHN COMPANY;WATHEN M; | This invention encompasses novel chimeric glycoproteins which are useful for preparing virus specific immune responses against human parainfluenza virus type 3, PIV3. Host cells transformed with structural genes coding for the glycoproteins, expression and replication plasmids containing the structural genes, vaccines made from the glycoproteins and methods for protecting humans by inoculation with said vaccines are also part of this invention | 1989 Mar 3 | 1989 Nov 2 |
| WO9002557 | VACCINES AND DIAGNOSTIC ASSAYS FOR HAEMOPHILUS INFLUENZAE | ANILIONIS A;SEID R;DEICH R;ZLOTNICK G;GREEN B; | PRAXIS BIOLOGICS I; | Peptides and proteins related to an epitope comprising an outer membrane protein of Haemophilus influenzae are described. The peptides and proteins can be prepared by methods including novel and improved methos of purification from H. influenzae cultures, and by recombinant DNA and chemical synthetic techniques. Additionally, recombinant vectors containing nucleotide sequences encoding PBOMP-1 and PBOMP-2 related peptides, proteins and fusion proteins are also described. Recombinant vectors include plasmid DNA and viral DNA such as human viruses, animal viruses, insect viruses and bacteriophages that direct the expression of the PBOMP-1 and PBOMP-2 related peptides, proteins, and fusion proteins in appropriate host cells. The peptides, proteins, fusion proteins and viruses both ''live'' and ''inactivated'' are used as immunogens in vaccine formulations to protect against H. influenzae infections. The peptides, proteins and fusion proteins are also used as reagents in immunoassays as well as to prepare immunoglobulins for passive immunization. Use of the nucleotide sequences encoding the PBOMP related peptides, proteins and fusion proteins in hybridization assays is also described | 1989 Aug 31 | 1990 Mar 22 |
| WO9409035 | NEW INFLUENZA VIRUS PEPTIDES, DIAGNOSTICS AND VACCINES | BLOMBERG J;PIPKORN Rd;VIAZOV S;ISAEVA E; | REPLICO MEDICAL AB;BLOMBERG J;PIPKORN Rd;VIAZOV S;ISAEVA E; | Provided are: Peptides, diagnostic antigens containing said peptides, antibodies against said peptides, a method of antibody purification, immunoassay methods, a vaccine composition containing said peptides and medicaments containing said peptides or antibodies against said peptides. The vaccine can protect humans and animals against infection caused by influenza A, B and C viruses. The immunoassay methods permit detection of influenza virus particles or viral antigens or antibodies to these antigens or disease caused by influenza viruses A, B and C. The medicaments can inhibit the reproduction of influenza viruses in infected humans and animals and modulate the course of influenza virus infection. The peptides are selected from the 7th segment of influenza A and B and the 6th segment of influenza C: (Influenza A virus) X-PHXLXXXFRRRPSFXTVFKXXXXXFEXKXIKNPQYXVQXXNDXXXXXXRXT-Z; (Influenza B virus) X-KKQIEAPISAFCISVRHLLFFIHSKAESRSNSFPPNQQCNFSASSALPSPSSV(23) ESR-Z; (Influenza C virus) X-PDIRGRCSFLISLAADLQADFPPVIAEIIAVLVSGATFFRNASVSAISISCAIV-Z (Influenza C virus) X-ISPHHLSHLPSTKPLTSSIMIFTNKYNIVIIPNPK EANVSMYPWVSLKQ-Z; and shorter variants thereof with at least 7 amino acids | 1993 Oct 11 | 1994 Apr 28 |
| WO9426903 | HUMAN INFLUENZA VIRUS PEPTIDES BINDING HLA-T MOLECULE | MELIEF C;KAST W; | RIJKSUNIVERSITEIT LEID;SEED CAPITAL INVESTMENTS S;MELIEF C;KAST W; | A peptide comprising an amino acid sequence derived from a human influenza virus protein, such as the human influenza M protein, wherein said amino acid sequence has the ability to bind to a human Major Histocompatibility Complex Class I molecule. Its use in prophylactic or therapeutic treatment of a human influenza virus-related disease, or in a diagnostic test or assay | 1994 May 18 | 1994 Nov 24 |
| WO9428026 | GENETICALLY ENGINEERED IMMUNOGLOBULINS | ZANETTI M;BILLETTA R; | THE REGENTS OF THE UNIVERSITY OF CALIFORNIA; | This invention relates to the introduction of oligopeptide epitopes of influenza virus nucleoprotein for expressing within the three dimensional fold of an immunoglobulin (Ig) molecule, thus creating molecules useful to induce specific, biologically active anti-viral immunity | 1994 May 25 | 1994 Dec 8 |
| WO9636357 | CARBOHYDRATE-MEDIATED COUPLING OF PEPTIDES TO IMMUNOGLOBULINS | BONA C;LEE Y;BRUMEANU TD;DEHAZYA P; | BONA C;LEE Y;BRUMEANU TD;DEHAZYA P; | The present invention relates to methods for enzymatically coupling peptides to immunoglobulin molecules via carbohydrate residues of immunoglobulin molecules, and to immunoglobulin-carbohydrate-linked peptide ('ICLP') conjugates produced by such methods. ICLP conjugates have been found to be superior in eliciting an immune response when compared to unconjugated peptide | 1996 May 13 | 1996 Nov 21 |
| WO9716207 | PEPTIDE EXPRESSION AND DELIVERY SYSTEM | TIMOTHY F;KYUNGCHEOL Y; | THE RESEARCH FOUNDATION OF STATE UNIVERSITY OF NEW YORK; | This invention relates to methods and compositions for producing a fusion protein comprised of Haemophilus influenzae P2 amino acid sequences, wherein the loop (5), or a portion thereof, is displayed a heterologous or homologous peptide sequence having biological activity. The fusion protein may be expressed on the surface of the host cell, such as in H. influenzae, which has been transformed with a fusion sequence that is operatively linked to at least one regulatory control element for expression of the fusion protein. Alternatively, the fusion protein can be purified from the host cell in the expression system, if the fusion protein remains associated with the host cell; or from the media of the expression system, if the fusion protein is a secreted form | 1996 Nov 1 | 1997 May 9 |
| WO9816829 | ORGANISM.ndash.SPECIFIC AND ALLERGEN.ndash.SPECIFIC ANTIBODY CAPTURE ASSAYAND COMPOSITIONS FOR DETECTION OF DISEASE.ndash.CAUSING ORGANISMS AND ALLERGENS | CALENOFF E; | ENTERON LP; | A new capture assay method employs novel compositions of reformulated antigens including epitopes specific for an organism that is a target of the assay, and epitopes specific for an allergen, wherein each antigen is present in equivalent amounts, and to which non-specific epitopes are added to remove non-specific binding as a confounding factor in the assay. The assay is suitable for detection of immunoglobulins directed to specific organisms, such as micro-organisms and parasites, and for allergens. For example, specific IgG in combination with IgE levels are used to detect Helicobacter pylori and Chlamydia pneumoniae and to monitor response to therapy | 1997 Oct 14 | 1998 Apr 23 |
| WO9858966 | A COMPOSITION FOR SPECIFIC IMMUNOPROTECTION AND METHOD FOR OBTAINING SAID COMPOSITION | GODIN NORM; | GODIN N; | The process specifically adapted for manufacturing a composition for specific immunoprotection against a disease-causing antigen comprises the following stages: 1) Determining the specific receptor(s) correlated with said disease; 2) obtaining antibodies, monoclonal or polyclonal or fragments thereof, to the antigenic epitopes of the active part of the receptor(s); 3) adding at least one immunity stimulating adjuvant. The composition obtained protects the receptors(s) against all present strains and possible future mutant strains of the pathogen(s) still capable of binding to that receptor(s). It does not involve the use of the pathogen in any direct or indirect form. In a particular advantageous embodiment, the invention is adapted for obtaining a composition for specific immunoprotection against the acquired immunodeficiency syndrome (AIDS) | 1997 Jun 24 | 1998 Dec 30 |
| WO9942479 | NOVEL PEPTIDE DIAGNOSTIC REAGENT AND KIT FOR DETECTION OF RICKETTSIOSIS | NILSSON KENN;PAAHLSON CARL; | PAHLSON C; | The present invention relates to a novel peptide, diagnostic reagent and kit for detection of rickettsiosis, more closely for detection of tick borne i(Rickettsia helvetica). The peptide comprises the amino acid sequence AAPSGSNVEWRNPDNGNYGYVTPNKTYR from the 17 kDa outer membrane protein. Furthemore, the invention relates to a vaccine against rickettsiosis comprising said peptide | 1999 Feb 19 | 1999 Aug 26 |
| WO0102678 | STAPHYLOCOCCUS AUREUS GENES AND POLYPEPTIDES | BAILEY C;CHOI G; | HUMAN GENOME SCIENCES I; | The present invention relates to novel genes from i(S. aureus) and the polypeptides they encode. Also provided are vectors, host cells, antibodies and recombinant methods for producing the same. The invention further relates to screening methods for identifying agonists and antagonists of i(S. aureus) polypetide activity. The invention additionally relates to diagnostic methods for detecting i(Staphylococcus) nucleic acids, polypeptides and antibodies in a biological sample. The present invention further relates to novel vaccines for the prevention or attenuation of infection by i(Staphylococcus) | 1999 Aug 31 | 2000 Mar 9 |
| WO017336 | DNA CASSETTE ENCODING A MULTIMER OF A BIOLOGICALLY ACTIVE PEPTIDE AND A CLEAVABLE LINKER ATTACHED THERETO AND PROCESS FOR PREPARING THE BIOLOGICALLY ACTIVE PEPTIDE | LEE SANG; | LEE S; | A biologically active peptide is prepared by: a) preparing an expression vector comprising a DNA cassette containing two or more tandem repeating units of a nucleotide sequence encoding a biologically active peptide and a linker peptide attached thereto, the linker peptide being cleavable by a protease or a chemical agent; b) transforming a microorganism with the expression vector; c) culturing the transformed microorganism to produce a multimeric peptide expressed by the DNA cassette; d) recovering and digesting the multimeric peptide with the protease or the chemical agent to obtain the biologically active peptide or an analog thereof carrying one or more amino acid residues originating from the linker peptide | 1999 Sep 17 | 2000 Mar 30 |
| WO0074716 | VACCINE | PRIEELS JP; | SMITHKLINE BEECHAM BIOLOGICALS SA; | The present invention provides a composition for the prophylaxis or treatment of allergy. The composition comprises a plurality of allergy peptides linked together by an inert carrier; characterised in that said allergy peptides are derived from IgE or IgE receptor, and that the inert carrier does not contain a peptidic T-cell helper epitope which is capable of binding to an MHC molecule and is capable of stimulating T-cell proliferation, and in a preferred embodiment the carrier does not provide bystander T-cell cytokine help in the induction of the anti-peptide immune response. Also provided are methods of their manufacture and their use in medicine. There is also provided a method of treatment of allergy comprising priming the immune system with an IgE peptide/protein conjugate, followed by boosting the immune response with a composition of the present invention | 2000 Jun 6 | 2000 Dec 14 |
| WO0170252 | NOVEL BORRELIA BURGDORFERI POLYPEPTIDES AND USES THEREOF | HUBER B;WILLETT T;MEYER A;GROSS D; | TUFTS UNIVERSITY; | The present invention provides novel polypeptides which are substantially free of a B. burgdorferi spirochete or fragments thereof and which are thus useful in compositions and methods for the treatment and prevention of B. burgdorferi infection and Lyme disease. In one preferred embodiment, this invention provides modified OspA polypeptides and pharmaceutically effective compositions and methods comprising those polypeptides. A preferred modified OspA polypeptide is set forth in Figure 1, below. Preferred modified OspA polypeptides are characterized by modifications which diminish and/or ablate their ability to bind the human MHC allele DRB*0401 | 2001 Mar 21 | 2001 Sep 27 |
| WO0170267 | CROSS-REACTIVE DISPLACING ANTIBODIES FROM COLLAGEN-BINDING PROTEINS AND METHOD OF IDENTIFICATION AND USE | HOOK M;XU Y;SPEZIALE P;VISAI L;CASOLINI F;PATTI J;PATEL P;DOMANSKI P; | INHIBITEX I;SYSTEM MU;UNIVERSITA' DEGLI STUDI DI PAVIA; | Antibodies to the CNA protein and to other regions from the collagen binding domain, including domain CNA19, are provided, and antibodies produced in this manner have been shown to be cross reactive to both Staphylococcus aureus and Staphylococcus epidermidis bacteria and which can thus be used in the prevention and treatment of infections caused by both of these types of bacteria. In addition, medical instruments can be treated using the antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the proteins are advantageous because they are cross-reactive and may thus be administered to patients so as to reduce or prevent severe infection by staphylococcal bacteria of more than one species. Antibodies generated in this manner have also been shown to exibit displacement activity and can thus be utilized advantageously in mehtods wherein these antibodies will be administered to patients having pre-existing staphylococcal infections because of the ability to displace bacterial proteins from binding sites on the extracellular matrix. Finally, a method of identifying, isolating and utilizing displacing antibodies is also provided | 2001 Mar 19 | 2001 Sep 27 |
| WO0196368 | USE OF COILED-COIL STRUCTURAL SCAFFOLD TO GENERATE STRUCTURE-SPECIFIC PEPTIDES | HOUSTON M;HODGES R; | CYTOVAX BIOTECHNOLOGIES I; | This invention relates to the use of a coiled-coil structural scaffold to generate structure-specific peptides, including synthetic peptides derived from naturally occurring proteins of various origin. The structure of the synthetic peptides utilizes a scaffold of heptad repeat units into which epitopes from coiled- coil regions of native proteins are spliced. In particular, the synthetic peptides may be based on microbial proteins, especially surface proteins, which occur naturally in the coiled-coil form such as pneumococcal surface proteins A and C. The synthetic peptides are immunogenic and can be used to elicit an immune response in an animal. Accordingly, they are useful as vaccines or to stimulate antibody production or cell-mediated immunity to the naturally occurring protein | 2001 Jun 14 | 2001 Dec 20 |
| WO0196379 | IMMUNIZATION OF DAIRY CATTLE WITH CHIMERIC GAPC PROTEIN AGAINST STREPTOCOCCUS INFECTION | POTTER A;PEREZ-CASAL J;FONTAINE M; | UNIVERSITY OF SASKATCHEWAN; | The recombinant production of Gap4, a chimeric GapC plasmin binding protein comprising the entire amino acid sequence of the Streptococcus dysgalactiae GapC protein in addition to unique amino acid sequences from the Streptococcus parauberis and Streptococcus agalactiae GapC proteins, is described. Also described is the use of Gap4 chimeric GapC protein in vaccine compositions to prevent or treat streptococcal infections in general and mastitis in particular | 2001 Jun 11 | 2001 Dec 20 |
| WO0198334 | STREPTOCOCCUS ANTIGENS | HAMEL J;OUELLET C;CHARLAND N;MARTIN D;BRODEUR B; | SHIRE BIOCHEM INC.; | Streptococcus polypeptides and polynucleotides encoding them are disclosed. Said polypeptides may be useful vaccine components for the prophylaxis or therapy of streptococcus infection in animals. Also disclosed are recombinant methods of producing the protein antigens as well as diagnostic assays for detecting streptococcus bacterial infection | 2001 Jun 19 | 2001 Dec 27 |
| WO0205845 | IMMUNOLOGICAL COMBINATIONS FOR PROPHYLAXIS AND THERAPY OF HELICOBACTER PYLORI INFECTION | GUY B;HAENSLER J; | MERIEUX ORAV; | The invention relates to multivalent compositions for preventing or treating Helicobacter infections. Multivalent Helicobacter component compositions useful in prophylaxis comprises at least two, preferably three components, that are selected from AlpA, catalase, urease, 525 protease and 76K proteins. Multivalent compositions useful in therapy include in particular 76K + caatalase + 525 protease, urease + 76K + catalase + 525 protease, AlpA + 76K + catalase + 525 protease, AlpA + 76K and AlpA + catalase | 2001 Jul 4 | 2002 Jan 24 |
| WO02072623 | GENES AND PROTEINS, AND THEIR USE | SANTANGELO J;FELDMAN R;LANE J;MOORE J;DOBSON R;HUGHES M;WILSON R;EVEREST P;DOUGAN G; | MICROSCIENCE LIMITED; | A protein from Group B Streptococcus is shown to be an outer surface protein and is a useful target for antimicrobial therapy | 2002 Mar 11 | 2002 Sep 19 |
| WO9112269 | IMMUNOLOGICALLY ACTIVE PEPTIDES OR POLYPEPTIDES FROM THE PARVOVIRUS B19 | SOUTSCHEK E;MOTZ M; | MIKROGEN MOLEKULARBIOLOGISCHE ENTW;SOUTSCHEK E;MOTZ M; | Immunologically active peptides or polypeptides with a partial amino acid sequence of the capside protein VP1 and VP2 of parvovirus B19 are obtained which provide an economical, sensitive and specific test to detect antibodies against the human parvovirus B19. Short peptide sequences are identified which when used as an antigen serve to identify anti-B19 IgG-positive sera. The production of these peptides by gene-technological means is revealed. Other gene-technologically produced antigens which form stably in large quantities in E. Coli and can subsequently be separated from them act as additional antigens for IgG confirmation. Finally a set of antigens facilitates testing for the detection of IgM antibodies against the virus. In addition, the gene-technologically produced components of the surface proteins are substances which may be used for prophylactic immunisation | 1991 Feb 8 | 1991 Aug 22 |
| WO9321220 | SYNTHETIC PEPTIDES USEFUL IN A VACCINE AGAINST AND IN THE DIAGNOSIS OF STREPTOCOCCAL INFECTION | GOOD M;PRUKSAKORN S; | THE COUNCIL OF THE QUEENSLAND INSTITUTE OF .;GOOD M;PRUKSAKORN S; | The present invention provides a synthetic peptide comprising at least on B cell epitope from the carboxyterminus of M protein of Group A ss-hemolitic streptococci wherein an antibody reactive to the B cell epitope is only minimally reactive to human heart tissue. The synthetic peptide may also contain a T cell epitope. The present invention further comtemplates a vaccine comprising the synthetic peptide and a method for vaccinating human subjects against streptococcal infection | 1993 Mar 30 | 1993 Oct 28 |
| WO9502066 | METHOD FOR INHIBITING PROCOAGULANT HLA-DR OF MELANOMA CELLS | CHELLADURAI M;HONN K;MOBASHERY S; | BIOMIDE INVESTMENT LIMITED; | A method for inhibiting procoagulant HLA-DR of melanoma cells is described. The inhibition is caused by the binding of HLA-DR with a 20 amino acid peptide or an inhibiting homologous subunit of the peptide. Kits for testing for the HLA-DR are also described | 1994 Jul 8 | 1995 Jan 19 |
| WO9625430 | HELICOBACTER PYLORI ANTIGEN | SMITH C;CLANCY R;CRIPPS A; | CORTECS LIMITED;SMITH C;CLANCY R;CRIPPS A; | A novel antigen from H. pylori is provided. Its use in diagnosing H. pylori infection is also disclosed, including methods for said diagnosis, and kits for use in such a method. In addition, novel antigenic fragments of the antigen are provided, as well as vaccines comprising either the antigen or one or more antigenic fragments | 1996 Feb 15 | 1996 Aug 22 |
| WO9721103 | TREATMENT AND DIAGNOSIS OF INFECTIONS DUE TO HELICOBACTER PYLORI | BURNIE J; | THE VICTORIA UNIVERSITY OF MANCHESTER; | The present invention provides agents for the detection of urease from H.pylori, and agents and epitopes for use in the treatment or diagnosis of infection due to H.pylori, as well as diagnostic tests and kits therefor and the use of the agents and epitopes in the manufacture of medicaments | 1996 Nov 27 | 1997 Jun 12 |
| WO9832768 | H. PYLORI ANTIGENS | CRIPPS A;CLANCY R;McSHANE L;SMITH C;TYREMAN D;HO B; | CORTECS (UK) LIMITED; | Novel antigens from H. pylori are provided. Their use in diagnosing H. pylori infection is also disclosed, including methods for said diagnosis, and kits for use in such a method. In addition, novel antigenic fragments of the antigens are provided, as well as vaccines comprising either at least one of the antigens or one or more antigenic fragments | 1998 Jan 26 | 1998 Jul 30 |
| WO9842740 | COMPOUNDS AND METHODS FOR THE DIAGNOSIS AND TREATMENT OF EHRLICHIA INFECTION | REED S;LODES M;HOUGHTON R; | CORIXA CORPORATION; | Compounds and methods for the diagnosis and treatment of i(Ehrlichia) infection, in particular human granulocytic ehrlichiosis, are disclosed. The compounds provided include polypeptides that contain at least one antigenic portion of an i(Ehrlichia) antigen and DNA sequences encoding such polypeptides. Pharmaceutical compositions and vaccines comprising such polypeptides or DNA sequences are also provided. Diagnostic kits containing such polypeptides or DNA sequences and a suitable detection reagent may be used for the detection of i(Ehrlichia) infection in patients and biological samples. Antibodies directed against such polypeptides are also provided | 1998 Mar 23 | 1998 Oct 1 |
| WO9954457 | VACCINE FORMULATIONS COMPRISING ANTIIDIOTYPIC ANTIBODIES WHICH IMMUNOLOGICALLY MIMIC GROUP B STREPTOCOCCAL CARBOHYDRATES | TETI G;POLONELLI L; | CHIRON SPA; | The invention relates to peptide, oligopeptide or polypeptide compounds that are capable of eliciting a protective immune response against the capsular polysaccharide of group B i(Streptococcus) (GBS), particularly type III GBS. Such compounds are useful in the development of vaccines that are effective against diseases caused by these pathogens | 1999 Apr 20 | 1999 Oct 28 |
| WO03069342A1 | A METHOD OF SCREENING | O'DONNELL R;DE KONING-WARD TF;CRABB B; | THE WALTER AND ELIZA HALL INSTITUTE OF MEDICAL RESEARCH; | A method of detecting the presence of a functionally inhibitory immunointeractive molecule in a biological sample. Preferably, the immunointeractive molecule is directed to a pathogen derived antigen and, more particularly, a parasite derived antigen and, even more particularly, a Plasmodium drived antigen. The method of the present invention facilitates detection of the presence of functionally inhibitory immunointeractive molecules, both in vitro and in vivo, and is useful for qualitatively and/or quantitatively assessing the immune status of individuals who have been previously infected with a parasite, predicting the immune status of individuals vaccinated with an antigen based vaccine, determining the relative contribution of a specific immunoreactivity of antibody to the total inhibitory antibody elicited by combination vaccines which include two or more antigens, assessing vaccines to determine the efficacy of different forms of an antigen, determining vaccine potency, assessing the protective potential of certain immunoreactivities of antibodies and determining the importance of parasite inhibitory antibodies | 2003 Feb 11 | 2003 Aug 21 |
| WO03089607A2 | CELL WALL MANNOPROTEINS AND ACTIVE EPITOPES FROM CANDIDA ALBICANS AND ANTIBODIES RECOGNIZING THEM | LOPEZ-RIBOT J; | BOARD OF REGENTS OF THE UNIVERSITY OF TEXAS SYSTEM; | An isolated surface protein known as mp58 is provided from the yeast candida albicans which has specific active peptide and carbohydrate regions and immunogenic epitopes therein and which elicits strong antibody responses during candidiasis. Antibodies raised from mp58 and the immunogenic regions and epitopes therein are also provided which can recognize the protein and its active regions and epitopes. The protein and antibodies of the present invention will thus be useful in methods of diagnosing, monitoring, treating or preventing infection of C. albicans and other yeast, and can also provide the basis for the development of immunity-based prophylactic, therapeutic and diagnostic techniques for the identification and management of disease conditions such as candidiasis | 2003 Apr 18 | 2003 Oct 30 |
| WO03091383A2 | EPHA2 ANTIGEN T EPITOPES | KOSMATOPOULOS K;ALVES P; | INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE;INSTITUT GUSTAVE ROUS; | The invention concerns peptides constituting T epitopes of EphA antigen, exhibited by MHC I. Said peptides are useful in particular in antitumoral immunotherapy | 2003 Apr 23 | 2003 Nov 6 |
| WO04026899A1 | IMMUNOGEN FOR PREPARATION OF THERAPEUTIC VACCINES OR DRUGS FOR TREATMENT OF HEPATITIS B AND THE PRODUCING METHOD AND USE THEREOF | WU Y;BIAN J;ZHOU W;JIA Z;SHI T;ZOU L; | INSTITUTE OF IMMUNOLOGY P;CHONGQING JIACHEN BIOENGINEERING CO. L; | The present invention relates to an immunogen for treatment of Hepatitis B, it's producing method and use, with said immunogen comprises a peptide sequence, which contains amino acid sequence 1, 2 and 3 that linked with each other by several linker peptides via covalent bond; wherein said amino acid sequence 1 is a sequence of T helper-cell (Th) epitopes, and said amino acid sequence 2 and 3 each is a sequence of Cytotoxic T-lymphocytel (CTL) epitopes and B-cell epitopes derived from Hepatitis B virus, respectively. The present invention also directs to vaccines or drugs composition containing the immunogen, and producing method and use thereof | 2003 Sep 18 | 2004 Apr 1 |
| WO04113369A1 | NOVEL SURFACE PROTEIN (HBSAG) VARIANT OF HEPATITIS B VIRUS | KRUPKA U; | DADE BEHRING MARBURG GMBH; | The invention relates to sequences of a novel variant of the Hepatitis B surface antigen (HBsAg) and to methods for detecting, in patient samples, nucleic acids, antigens and antibodies directed against the same | 2004 Jun 17 | 2004 Dec 29 |
| WO05058948A1 | LSA-5 LIVER STAGE AND BLOOD STAGE ANTIGEN OF PLASMODIUM FALCIPARUM, IMMUNOGENIC COMPOSITION COMPRISING SAID ANTIGEN, AND VACCINES AGAINST MALARIA | DRUILHE P;BRAHIMI-ZEGHIDOUR K; | INSTITUT PAST; | The present invention pertains to the protection against malaria. More particularly, the invention is based on the characterization of a novel liver and sporozoite-stage P. falciparum antigen, referred to as LSA-5. This antigen is highly antigenic and the prevalence of antibodies in subjects living in endemic areas is extremely high (ca. 90 %). The invention concerns antigenic peptides, mixtures thereof, or polypeptides, mixotopes and conjugates comprising part of the sequence of LSA-5, as well as immunogenic compositions, vaccines and kits comprising these | 2004 Dec 15 | 2005 Jun 30 |
| WO05063805A1 | ANTIBODIES AGAINST THE AMINO TERMINUS REGION OF CIRCUMSPOROZOITE PROTEIN PREVENT THE ONSET OF MALARIA INFECTION | RATHORE D;MCCUTCHAN T; | THE GOVERNMENT OF THE UNITED STATES OF AMERICA ARBTSDOHAHS; | The present invention relates to a polypeptide comprising a sequence as shown as the Peptide P6-identified epitope domain from amino acid 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, or 93 - 113, 114, 115, 116, or 117 of the Circumsporozoite protein, or allelic variant, functional equivalent, derivative, homologue, or analogue thereof, that reacts with antibodies that inhibit liver cell invasion by P. falciparum, substantially in isolation from sequences naturally occurring adjacent thereto in the Circumsporozoite protein | 2004 Dec 20 | 2005 Jul 14 |
| WO06041933A2 | IMPROVED VACCINES | HICKLE L;ANDERSON A;BROWN R;BUDWORTH P;DJORDJEVIC G;KROKEN S;LUGINBUHL P;RICHARDSON T;HANSEN G; | DIVERSA CORPORATION; | The present invention relates to compositions for inducing immune responses, including an antigen and a promiscuous T-cell epitope. Also provided are methods of inducing immune responses in hosts, comprising administering compositions comprising antigens and promiscuous T-cell epitopes to the host | 2005 Oct 5 | 2006 Apr 20 |
| WO06069718A1 | IMMUNOGENIC COMPOSITIONS OF CYCLIC PEPTIDES DERIVED FRO THE BETA-AMYLOID PEPTIDE | ZURBRIGGEN R; | PEVION BIOTECH LTD.; | The present invention relates to methods and compositions for the elicitation of an immune response against amyloid betapeptides, in particular by the combinatory use of virosomes as adjuvants and a synthetic amyloid beta-peptide antigen | 2005 Dec 21 | 2006 Jul 6 |
| WO06071896A2 | EPITOPE-BASED SARS VACCINE | GUO Z;ZHONG X;GUO Z;YANG H;XIE Y; | THE HONG KONG UNIVERSITY OF SCIENCE AND TECHNOLOGY; | This invention provides a vaccine for the infectious severe acute respiratory syndrome (SARS), which comprises antigenic epitopes from the pathogenic coronavirus. The antigenic epitopes were determined from the complementary antibodies in the plasma of convalescent SARS patients through phage display epitope mapping. These immunodominants consit of short peptide fragments distributed on various viral proteins, which includes, the spike protein, the nucleocapsid protein, the replicase 1a, and the unknown proteins 3a and 9b. Complementary antibodies targeting the immunodominant site on the spike protein effectively neutralize the coronavirus<i>in vitro</i>. This epitope-based vaccine avoids potential immunopathologic effects found in vaccines for other human or animal diseases since the epitopes induced safe and benificial humoral antibodies in convalescent SARS patients | 2005 Dec 23 | 2006 Jul 6 |
| WO06076678A2 | PROSTATE STEM CELL ANTIGEN VACCINES AND USES THEREOF | JAFFEE E; | THE JOHNS HOPKINS UNIVERSITY; | This invention relates to the identification of prostate stem cell antigen (PSCA) as a target of clinically relevant antitumor immune responses. The invention provides vaccines comprising PSCA, or fragments thereof, which are useful in inducing antitumor immune responses, including PSCA specific CD8+ T cell responses. Methods of using the compositions to treat cancer are also provided. The invention further provides methods of identifying compounds useful in antitumor vaccines and methods of assessing the responses of patients to cancer immunotherapy | 2006 Jan 13 | 2006 Jul 20 |
| WO06078657A2 | COMPOSITIONS OF PATHOGEN-ASSOCIATED MOLECULAR PATTERNS AND METHODS OF USE | POWELL T;NAKAAR V;SONG L;HULEATT J;MCDONALD W;HEWITT D; | VAXINNATE CORPORATION; | Compositions comprise at least a portion of an antigen and at least a portion of a flagellin that lacks a hinge region. Compositions, fusion proteins and polypeptides comprise at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein. The viral protein of the compositions, fusion proteins and polypeptides of the invention are flaviviral proteins, including a West Nile flaviviral protein, a Dengue flaviviral protein, a Langat flaviviral protein, a Kunjin flaviviral protein, a Murray Valley encephalitis flaviviral protein, a Japanese encephalitis flaviviral protein, a Tick- borne encephalitis flaviviral protein, a Yellow fever flaviviral protein and a hepatitis C flaviviral protein. The compositions, fusion proteins and polypeptides are used to stimulate an immune response in a subject | 2006 Jan 19 | 2006 Jul 27 |
| WO06083322A2 | METHODS FOR THE TREATMENT AND PREVENTION OF INFECTION USING ANTI-SELECTIN AGENTS | JUTILA M;BARGATZE R;PALECANDA A;GLEE P; | LIGOCYTE PHARMACEUTICALS I;MONTANA STATE UNIVERSITY; | Methods for the treatment and prevention of pulmonary infections are disclosed, in particular, methods comprising the administration of one or more anti-selectin agents to a patient diagnosed with a pulmonary infection. Anti-selectin agents that inhibit leukocyte recruitment to the lungs have been found to be beneficial for the treatment of lung infections, including infections associated with chronic bronchitis, chronic obstructive pulmonary disease (COPD), pneumonia, pneumonitis, acute respiratory distress syndrome (ARDS), severe acute respiratory syndrome (SARS), sarcoidosis, cystic fibrosis (CF), emphysema, asthma, smoker's cough, allergy, allergic rhinitis, sinusitis and pulmonary fibrosis | 2005 Jul 27 | 2006 Aug 10 |
| WO06085918A2 | RABBIT MONOCLONAL ANTIBODIES TO HEPATITIS B SURFACE ANTIGENS AND METHODS OF USING THE SAME | CHIEN DY;FONG Yl;TABRIZI A;TODD H;VANCLEVE MD; | CHIRON CORPORATION; | Reagents, methods and immunodiagnostic test kits for the accurate detection of hepatitis B virus (HBV) infection are disclosed. The methods and kits employ novel rabbit monoclonal antibodies directed against HBV surface antigens (HBsAg) with mutations in the 'a' determinant region of HBsAg | 2005 Jun 7 | 2006 Aug 17 |
| WO06085933A2 | IMMUNOGENIC SARS DOMAIN | BEADENKOPF R; | BECTON DAC; | Potentially antigenic, conserved and specific |